Clone BS28115 Report

Search the DGRC for BS28115

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:281
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptCG7587-RA
Protein status:BS28115.pep: gold
Sequenced Size:461

Clone Sequence Records

BS28115.complete Sequence

461 bp assembled on 2012-03-05

GenBank Submission: KX801101

> BS28115.complete
GAAGTTATCAGTCGACATGTTCAATATTATCCTTCTGGCAACAATCCTAG
TGAGCGTGGCTCAGGCCACAATCATCATTAAGCCCGAAAATCCCGTGGAG
GAGACCACCAAGTGCCAGATCTACTGGCGCGAACACGCCTGGGCTCTTGA
AGATTGTGTGTGCCGGGTCTTCCAGAACGGCTGTCTTCTGAACGAGGAGA
GCAATCGGCGGGAAAAGGCTGGAAAAACCCCTCTAATTCCGGTCACCGAG
CAGGTGTGCCAGAAGTTCATCAAGCGCAAGTGCTTCCTTGGATGGCCTGT
GCTGGCCAAGTTCCCGATTCCATCGCCATGCGGATGCAATGGCAAACAGG
GCAGTCTGGAAATCAAGAAGTTTTTGAGTCTGTGCGAACTGCAGAAGTAC
GCAGCTGAATGCAACAAACCCTATATCAGCTACTCGAAGTGTTAAAAGCT
TTCTAGACCAT

BS28115.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG7587-RA 429 CG7587-PA 1..429 17..445 2145 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG7587-RA 550 CG7587-RA 38..469 17..448 2160 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17594423..17594636 17..230 1070 100 Plus
3R 32079331 3R 17594702..17594890 231..419 945 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:26:23 has no hits.

BS28115.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:16:22 Download gff for BS28115.complete
Subject Subject Range Query Range Percent Splice Strand
CG7587-RA 43..464 22..443 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:34:53 Download gff for BS28115.complete
Subject Subject Range Query Range Percent Splice Strand
CG7587-RA 43..464 22..443 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:18:16 Download gff for BS28115.complete
Subject Subject Range Query Range Percent Splice Strand
CG7587-RA 43..464 22..443 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:18:16 Download gff for BS28115.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17594428..17594636 22..230 100 -> Plus
3R 17594702..17594890 231..419 100 -> Plus
3R 17594948..17594971 420..443 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:34:53 Download gff for BS28115.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13420150..13420358 22..230 100 -> Plus
arm_3R 13420424..13420612 231..419 100 -> Plus
arm_3R 13420670..13420693 420..443 100   Plus

BS28115.pep Sequence

Translation from 16 to 444

> BS28115.pep
MFNIILLATILVSVAQATIIIKPENPVEETTKCQIYWREHAWALEDCVCR
VFQNGCLLNEESNRREKAGKTPLIPVTEQVCQKFIKRKCFLGWPVLAKFP
IPSPCGCNGKQGSLEIKKFLSLCELQKYAAECNKPYISYSKC*

BS28115.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG7587-PA 142 CG7587-PA 1..142 1..142 772 100 Plus
Sgs5-PA 163 CG7596-PA 1..160 1..142 395 46.2 Plus
CG42823-PA 151 CG42823-PA 38..143 32..138 145 33.6 Plus