BS28126.complete Sequence
263 bp assembled on 2012-03-05
GenBank Submission: KX804988
> BS28126.complete
GAAGTTATCAGTCGACATGAAAGCTCTTCAAGTCGCCGGAACTTTGATGC
TGCTTTTCTGCCTGCTGGCAGCTGTTAATGCTACGCCGGGACAAGTGTAT
ATCAATGGGAAATGCATTGACTGCAATAAGCCTGATAATGATCCGGGAAT
TATAATTCCTCCAGACCATAAATCAGCTGGATCCATGTCTTACACACTCA
CATCTGGAGCCATCTTCTTTGGAATTATATATCATATATTCAGTTAAAAG
CTTTCTAGACCAT
BS28126.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:28:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16836-RA | 231 | CG16836-PA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:28:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16836-RA | 383 | CG16836-RA | 104..337 | 15..248 | 1170 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:28:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 18389229..18389397 | 80..248 | 845 | 100 | Plus |
2R | 25286936 | 2R | 18389098..18389163 | 15..80 | 330 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 08:28:15 has no hits.
BS28126.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:16:26 Download gff for
BS28126.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16836-RA | 6..234 | 17..245 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:35:28 Download gff for
BS28126.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16836-RA | 106..334 | 17..245 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:18:49 Download gff for
BS28126.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16836-RA | 106..334 | 17..245 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:18:49 Download gff for
BS28126.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18389100..18389163 | 17..80 | 100 | -> | Plus |
2R | 18389230..18389394 | 81..245 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:35:28 Download gff for
BS28126.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 14276605..14276668 | 17..80 | 100 | -> | Plus |
arm_2R | 14276735..14276899 | 81..245 | 100 | | Plus |
BS28126.pep Sequence
Translation from 16 to 246
> BS28126.pep
MKALQVAGTLMLLFCLLAAVNATPGQVYINGKCIDCNKPDNDPGIIIPPD
HKSAGSMSYTLTSGAIFFGIIYHIFS*
BS28126.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:48:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16836-PA | 76 | CG16836-PA | 1..76 | 1..76 | 402 | 100 | Plus |