Clone BS28126 Report

Search the DGRC for BS28126

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:281
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptCG16836-RA
Protein status:BS28126.pep: gold
Sequenced Size:263

Clone Sequence Records

BS28126.complete Sequence

263 bp assembled on 2012-03-05

GenBank Submission: KX804988

> BS28126.complete
GAAGTTATCAGTCGACATGAAAGCTCTTCAAGTCGCCGGAACTTTGATGC
TGCTTTTCTGCCTGCTGGCAGCTGTTAATGCTACGCCGGGACAAGTGTAT
ATCAATGGGAAATGCATTGACTGCAATAAGCCTGATAATGATCCGGGAAT
TATAATTCCTCCAGACCATAAATCAGCTGGATCCATGTCTTACACACTCA
CATCTGGAGCCATCTTCTTTGGAATTATATATCATATATTCAGTTAAAAG
CTTTCTAGACCAT

BS28126.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG16836-RA 231 CG16836-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG16836-RA 383 CG16836-RA 104..337 15..248 1170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18389229..18389397 80..248 845 100 Plus
2R 25286936 2R 18389098..18389163 15..80 330 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:28:15 has no hits.

BS28126.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:16:26 Download gff for BS28126.complete
Subject Subject Range Query Range Percent Splice Strand
CG16836-RA 6..234 17..245 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:35:28 Download gff for BS28126.complete
Subject Subject Range Query Range Percent Splice Strand
CG16836-RA 106..334 17..245 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:18:49 Download gff for BS28126.complete
Subject Subject Range Query Range Percent Splice Strand
CG16836-RA 106..334 17..245 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:18:49 Download gff for BS28126.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18389100..18389163 17..80 100 -> Plus
2R 18389230..18389394 81..245 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:35:28 Download gff for BS28126.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14276605..14276668 17..80 100 -> Plus
arm_2R 14276735..14276899 81..245 100   Plus

BS28126.pep Sequence

Translation from 16 to 246

> BS28126.pep
MKALQVAGTLMLLFCLLAAVNATPGQVYINGKCIDCNKPDNDPGIIIPPD
HKSAGSMSYTLTSGAIFFGIIYHIFS*

BS28126.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG16836-PA 76 CG16836-PA 1..76 1..76 402 100 Plus