Clone BS28127 Report

Search the DGRC for BS28127

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:281
Well:27
Vector:pDNR-Dual
Associated Gene/TranscriptCG4186-RA
Protein status:BS28127.pep: full length peptide match
Sequenced Size:290

Clone Sequence Records

BS28127.complete Sequence

290 bp assembled on 2012-03-05

GenBank Submission: KX805018

> BS28127.complete
GAAGTTATCAGTCGACATGCCTCGCAATCAAAACGCAGAGCAGGATAATC
CCTGCCTAAAGGAACAGGAGCTTTCATTTAAATGCCTCAACAAAAACAAC
TTTGATCGCGACAAGTGCGAAATATATTTTGCCAATTATAACAATTGCAA
GGAGTTCTGGAACAAAGTAAAAACCGAAAGGAGAGCCAAGGGAATAGCTC
CTTATTTGCCGCCCTTAGAAGAACGCGATGGGATTAAAGCAGAATATATG
AAAGGAAAACCCCAACAAAGCTGAAAGCTTTCTAGACCAT

BS28127.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:28:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG4186-RB 258 CG4186-PB 1..258 17..274 1290 100 Plus
CG4186-RA 258 CG4186-PA 1..258 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:28:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG4186-RB 444 CG4186-RB 56..313 17..274 1290 100 Plus
CG4186-RA 386 CG4186-RA 56..313 17..274 1290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:28:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20769893..20770007 160..274 575 100 Plus
3L 28110227 3L 20769737..20769837 60..160 505 100 Plus
3L 28110227 3L 20769641..20769686 17..62 230 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:28:41 has no hits.

BS28127.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:16:27 Download gff for BS28127.complete
Subject Subject Range Query Range Percent Splice Strand
CG4186-RA 56..312 17..273 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:35:32 Download gff for BS28127.complete
Subject Subject Range Query Range Percent Splice Strand
CG4186-RA 56..312 17..273 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:18:56 Download gff for BS28127.complete
Subject Subject Range Query Range Percent Splice Strand
CG4186-RA 56..312 17..273 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:18:56 Download gff for BS28127.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20769641..20769685 17..61 100 -> Plus
3L 20769739..20769837 62..160 100 -> Plus
3L 20769894..20770006 161..273 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:35:32 Download gff for BS28127.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20762741..20762785 17..61 100 -> Plus
arm_3L 20762839..20762937 62..160 100 -> Plus
arm_3L 20762994..20763106 161..273 100   Plus

BS28127.pep Sequence

Translation from 16 to 273

> BS28127.pep
MPRNQNAEQDNPCLKEQELSFKCLNKNNFDRDKCEIYFANYNNCKEFWNK
VKTERRAKGIAPYLPPLEERDGIKAEYMKGKPQQS*

BS28127.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG4186-PB 85 CG4186-PB 1..85 1..85 472 100 Plus
CG4186-PA 85 CG4186-PA 1..85 1..85 472 100 Plus