Clone BS28129 Report

Search the DGRC for BS28129

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:281
Well:29
Vector:pDNR-Dual
Associated Gene/TranscriptCG4269-RA
Protein status:BS28129.pep: full length peptide match
Sequenced Size:341

Clone Sequence Records

BS28129.complete Sequence

341 bp assembled on 2012-03-05

GenBank Submission: KX802912

> BS28129.complete
GAAGTTATCAGTCGACATGGCTAAGAATATGTTCAGCAATATATTGGTGG
TGACACTACTCGTACTCAGTTCGGATGTCGAAGCACGACCCTCCTCCTCG
GGTGTTGGTGGTGAGGCGAACGTGGATCCCAGCGAATACCACGGCAATCT
GTCGGTGGAAACGGTGCTAAAAGTGCAGCAGTGCGAGAAGGACACCAACA
CGATGGAGCTGTGCATGCGGTGCGCCAAGGTGACCAAGTCGGAATTCGTC
TATCCCATGTGCTGCGGCAACGAAGATGGCATCAAGGACTGGTGCCGGGA
GTATGTGTACTTCGGCAACGAGTAGAAGCTTTCTAGACCAT

BS28129.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG4269-RC 309 CG4269-PC 1..309 17..325 1545 100 Plus
CG4269-RA 309 CG4269-PA 1..309 17..325 1545 100 Plus
CG4269-RB 297 CG4269-PB 1..297 29..325 1485 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG4269-RC 898 CG4269-RC 102..411 17..326 1550 100 Plus
CG4269-RA 539 CG4269-RA 102..411 17..326 1550 100 Plus
CG4269-RB 1311 CG4269-RB 886..1183 29..326 1490 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22599911..22600208 29..326 1490 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:28:58 has no hits.

BS28129.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:16:28 Download gff for BS28129.complete
Subject Subject Range Query Range Percent Splice Strand
CG4269-RA 85..393 17..325 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:35:42 Download gff for BS28129.complete
Subject Subject Range Query Range Percent Splice Strand
CG4269-RA 102..410 17..325 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:19:02 Download gff for BS28129.complete
Subject Subject Range Query Range Percent Splice Strand
CG4269-RA 102..410 17..325 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:19:02 Download gff for BS28129.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22599911..22600207 29..325 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:35:42 Download gff for BS28129.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18487416..18487712 29..325 100   Plus

BS28129.pep Sequence

Translation from 16 to 324

> BS28129.pep
MAKNMFSNILVVTLLVLSSDVEARPSSSGVGGEANVDPSEYHGNLSVETV
LKVQQCEKDTNTMELCMRCAKVTKSEFVYPMCCGNEDGIKDWCREYVYFG
NE*

BS28129.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG4269-PC 102 CG4269-PC 1..102 1..102 545 100 Plus
CG4269-PA 102 CG4269-PA 1..102 1..102 545 100 Plus
CG4269-PB 98 CG4269-PB 1..98 5..102 525 100 Plus