Clone BS28131 Report

Search the DGRC for BS28131

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:281
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptEdg78E-RA
Protein status:BS28131.pep: gold
Sequenced Size:401

Clone Sequence Records

BS28131.complete Sequence

401 bp assembled on 2012-03-05

GenBank Submission: KX800592

> BS28131.complete
GAAGTTATCAGTCGACATGTACAAATATCTGTTCTGTCTTGCTCTCATCG
GCTGCGCCTGCGCCGACAACATCAACAAGGATGCCCAGATCCGCAGCTTC
CAGAACGACGCTACCGATGCTGAGGGCAACTACCAGTACGCCTACGAGAC
CAGCAATGGCATCCAGATCCAGGAGGCGGGCAACGCCAACGGAGCACGTG
GTGCCGTGGCTTACGTGTCGCCCGAGGGCGAGCACATCTCGCTGACATAC
ACCGCCGACGAGGAGGGCTACCATCCAGTGGGTGACCACCTGCCCACCCC
GCCCCCAGTTCCGGCTTACGTTCTCCGTGCCCTGGAATATATCCGCACCC
ATCCCCCGGCGCCCGCCCAGAAGGAGCAGCAGTAAAAGCTTTCTAGACCA
T

BS28131.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
Edg78E-RB 369 CG7673-PB 1..369 17..385 1845 100 Plus
Edg78E-RA 369 CG7673-PA 1..369 17..385 1845 100 Plus
Cpr78Cc-RA 360 CG7658-PA 107..336 114..343 250 73.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
Edg78E-RB 546 CG7673-RB 76..445 16..385 1850 100 Plus
Edg78E-RA 967 CG7673-RA 76..445 16..385 1850 100 Plus
Cpr78Cc-RA 522 CG7658-RA 148..377 114..343 250 73.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21297285..21297641 385..29 1785 100 Minus
3L 28110227 3L 21300797..21301026 114..343 250 73.9 Plus
Blast to na_te.dros performed 2014-11-28 08:29:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\ISBu2 726 Dbuz\ISBu2 ISBU2 726bp 588..644 220..166 108 70.2 Minus

BS28131.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:16:29 Download gff for BS28131.complete
Subject Subject Range Query Range Percent Splice Strand
Edg78E-RA 77..443 17..383 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:35:49 Download gff for BS28131.complete
Subject Subject Range Query Range Percent Splice Strand
Edg78E-RA 77..443 17..383 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:19:09 Download gff for BS28131.complete
Subject Subject Range Query Range Percent Splice Strand
Edg78E-RA 77..443 17..383 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:19:09 Download gff for BS28131.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21297287..21297641 29..383 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:35:49 Download gff for BS28131.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21290387..21290741 29..383 100 <- Minus

BS28131.pep Sequence

Translation from 16 to 384

> BS28131.pep
MYKYLFCLALIGCACADNINKDAQIRSFQNDATDAEGNYQYAYETSNGIQ
IQEAGNANGARGAVAYVSPEGEHISLTYTADEEGYHPVGDHLPTPPPVPA
YVLRALEYIRTHPPAPAQKEQQ*

BS28131.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:48:55
Subject Length Description Subject Range Query Range Score Percent Strand
Edg78E-PB 122 CG7673-PB 1..122 1..122 658 100 Plus
Edg78E-PA 122 CG7673-PA 1..122 1..122 658 100 Plus
Cpr78Cc-PA 119 CG7658-PA 1..119 1..116 371 60.5 Plus
Cpr65Ec-PA 127 CG8634-PA 14..124 11..121 291 49.1 Plus
Cpr67Fa1-PA 134 CG7941-PA 1..117 1..113 272 50 Plus