Clone BS28167 Report

Search the DGRC for BS28167

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:281
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptCG42302-RA
Protein status:BS28167.pep: full length peptide match
Sequenced Size:398

Clone Sequence Records

BS28167.complete Sequence

398 bp assembled on 2012-03-05

GenBank Submission: KX804999

> BS28167.complete
GAAGTTATCAGTCGACATGGCCACGAACCAGCACGACCTCGAGCGGATTC
GCCAGCAGATCGTGTTGGCCAACATTCAGGAGCTGATAAAGAAGATGACA
CGTCGCTGCTTCGACGTATGTATCGCTATGCCGGAAATGGAGTTGCGCTC
CACGGAGCGCGACTGCCTGGCCAACTGTATGGATCGATTCATGGACTCGG
TTCAGGTGGTGTCGAGCCAGTACTTCCGTCGCCGGCGTCGCCATCAGCAA
ATTCGTTTGTCCCGTTCGACCGCCTCCTCCGCATCACCACCAGCATCCGC
ATCCGCATCCATGCCCAAATCCGCAGCAGCAAATGAATCTGAATCCGCAT
CTAGGGCCTCCAATGACGAAAAGGTCAAATAAAAGCTTTCTAGACCAT

BS28167.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:01:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG42302-RA 366 CG42302-PA 1..366 17..382 1830 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG42302-RA 759 CG42302-RA 76..441 17..382 1830 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:01:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18725232..18725597 382..17 1830 100 Minus
Blast to na_te.dros performed on 2014-11-28 05:01:01 has no hits.

BS28167.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:16:40 Download gff for BS28167.complete
Subject Subject Range Query Range Percent Splice Strand
CG42302-RA 1..364 17..380 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:28:55 Download gff for BS28167.complete
Subject Subject Range Query Range Percent Splice Strand
CG42302-RA 1..364 17..380 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:02:22 Download gff for BS28167.complete
Subject Subject Range Query Range Percent Splice Strand
CG42302-RA 76..439 17..380 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:02:22 Download gff for BS28167.complete
Subject Subject Range Query Range Percent Splice Strand
X 18725234..18725597 17..380 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:28:55 Download gff for BS28167.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18619267..18619630 17..380 100   Minus

BS28167.pep Sequence

Translation from 16 to 381

> BS28167.pep
MATNQHDLERIRQQIVLANIQELIKKMTRRCFDVCIAMPEMELRSTERDC
LANCMDRFMDSVQVVSSQYFRRRRRHQQIRLSRSTASSASPPASASASMP
KSAAANESESASRASNDEKVK*

BS28167.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG42302-PA 121 CG42302-PA 1..121 1..121 602 100 Plus
Tim13-PA 92 CG11611-PA 12..81 8..77 185 48.6 Plus
CG34132-PA 84 CG34132-PA 12..81 8..77 175 44.3 Plus