Clone BS28218 Report

Search the DGRC for BS28218

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:282
Well:18
Vector:pDNR-Dual
Associated Gene/Transcriptvsg-RC
Protein status:BS28218.pep: full length peptide match
Sequenced Size:584

Clone Sequence Records

BS28218.complete Sequence

584 bp assembled on 2012-03-05

GenBank Submission: KX802556

> BS28218.complete
GAAGTTATCAGTCGACATGAATCGGCAGGCGAAATTCCTAATCTTGTGCC
TCTTTGTGGGCCTCTTCTCCGCGAATTTGTGCGAAGAAGCAGTGACCACA
CCGGCTCCAGCGGACACCACCACCCAGGAATCCAAGAACACCACCACTCC
GCCGGACACCACCACTACTGTGACGCCACCGTCGACCTCAACCACGAGCA
CCACAACTGAAAAGACCACGACGACGCCACCAATTACCACATCGACTGAG
AAGACCACAACTTCCACTACTCCAGCCAGCACCACCAGCAGCACCACTCC
GGCCAGCACCACCAGCAGCACCACTCCGGCAACGACCACCACCACGCCTG
GAACTACATCTACGACCACTCCGTCTCCGAACTCGACCACAACTACGCCG
CCGCCACACACATCAACCACTCCGGCGCCGAAGCCCGTGCCGTGCGGTCA
TTTCGATGGATCCTCGTTCATTGGCGGCATTGTGCTGACTCTGGGCCTGC
TCGCTATCGGCTTAGTGGCCTACAAGTTCTACAAGGCCCGCAACGAGCGC
AACTACCACACCCTTTGAAAGCTTTCTAGACCAT

BS28218.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
vsg-RC 552 CG16707-PC 1..552 17..568 2760 100 Plus
vsg-RD 552 CG16707-PD 1..552 17..568 2760 100 Plus
vsg-RE 789 CG16707-PE 1..549 17..568 2680 99.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:08:55
Subject Length Description Subject Range Query Range Score Percent Strand
vsg-RC 2167 CG16707-RC 122..673 17..568 2760 100 Plus
vsg-RD 2273 CG16707-RD 228..779 17..568 2760 100 Plus
vsg-RE 2164 CG16707-RE 122..670 17..568 2680 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9715742..9716222 88..568 2405 100 Plus
3L 28110227 3L 9714551..9714623 17..89 365 100 Plus
Blast to na_te.dros performed on 2014-11-28 05:08:53 has no hits.

BS28218.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-05 16:16:46 Download gff for BS28218.complete
Subject Subject Range Query Range Percent Splice Strand
vsg-RC 111..661 17..567 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:29:41 Download gff for BS28218.complete
Subject Subject Range Query Range Percent Splice Strand
vsg-RD 228..778 17..567 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:04:59 Download gff for BS28218.complete
Subject Subject Range Query Range Percent Splice Strand
vsg-RD 228..778 17..567 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:04:59 Download gff for BS28218.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9714551..9714623 17..89 100 -> Plus
3L 9715744..9716221 90..567 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:29:41 Download gff for BS28218.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9707651..9707723 17..89 100 -> Plus
arm_3L 9708844..9709321 90..567 100   Plus

BS28218.pep Sequence

Translation from 16 to 567

> BS28218.pep
MNRQAKFLILCLFVGLFSANLCEEAVTTPAPADTTTQESKNTTTPPDTTT
TVTPPSTSTTSTTTEKTTTTPPITTSTEKTTTSTTPASTTSSTTPASTTS
STTPATTTTTPGTTSTTTPSPNSTTTTPPPHTSTTPAPKPVPCGHFDGSS
FIGGIVLTLGLLAIGLVAYKFYKARNERNYHTL*

BS28218.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:49:44
Subject Length Description Subject Range Query Range Score Percent Strand
vsg-PC 183 CG16707-PC 1..183 1..183 954 100 Plus
vsg-PD 183 CG16707-PD 1..183 1..183 954 100 Plus
vsg-PB 182 CG16707-PB 1..182 1..183 938 99.5 Plus
vsg-PA 182 CG16707-PA 1..182 1..183 938 99.5 Plus
vsg-PE 262 CG16707-PE 1..182 1..183 938 99.5 Plus