Clone BS28348 Report

Search the DGRC for BS28348

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:283
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptCG7829-RB
Protein status:BS28348.pep: full length peptide match
Sequenced Size:425

Clone Sequence Records

BS28348.complete Sequence

425 bp assembled on 2012-03-08

GenBank Submission: KX803086

> BS28348.complete
GAAGTTATCAGTCGACATGATGTACAAGTTATGGTGGAAATTGCTTCTCC
TCCAGGCTTCTGGGTGTCTATCTCTGGAGAGTCGCCCAGATCCACGCATA
GTCGGTGGCTTCCCAGCCGATATCGCCAACATTCCGTACATAGTGTCCAT
CCAACTGTACGGCATCCACCATTGTGGCGGCTCCATAATAAATAACCACA
CCATCCTAACGGCTGGCCATTGTCTGAACGGAGTGCCACATCGCCTGCTG
AAAGTTAAGGTCGGCGGAACGTCGCGCTACCGAAAAGATGGGGAACTGTT
CTCGGTCGCTGACCTGCAAGTCCACGAGAATTTCAATCCCAAGACCATGG
ACTATGACATCGGTATCATCAGGTTGACCAAAAACCTAACACTATCTAGA
AAGGTTTGAAAGCTTTCTAGACCAT

BS28348.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 07:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG7829-RA 762 CG7829-PA 1..389 17..405 1945 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 07:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG7829-RA 976 CG7829-RA 37..425 17..405 1945 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 07:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29817334..29817728 411..17 1975 100 Minus
Blast to na_te.dros performed on 2014-11-28 07:41:48 has no hits.

BS28348.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-08 17:47:30 Download gff for BS28348.complete
Subject Subject Range Query Range Percent Splice Strand
CG7829-RB 37..428 17..408 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:08 Download gff for BS28348.complete
Subject Subject Range Query Range Percent Splice Strand
CG7829-RA 37..425 17..408 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:01:56 Download gff for BS28348.complete
Subject Subject Range Query Range Percent Splice Strand
CG7829-RA 37..425 17..408 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:01:56 Download gff for BS28348.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29817337..29817728 17..408 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:08 Download gff for BS28348.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25643059..25643450 17..408 100   Minus

BS28348.pep Sequence

Translation from 16 to 408

> BS28348.pep
MMYKLWWKLLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGI
HHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGGTSRYRKDGELFSVADL
QVHENFNPKTMDYDIGIIRLTKNLTLSRKV*

BS28348.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG7829-PA 253 CG7829-PA 1..130 1..130 692 100 Plus
epsilonTry-PA 256 CG18681-PA 28..132 25..130 222 42.5 Plus
gammaTry-PA 253 CG30028-PA 5..132 9..130 207 37.2 Plus
deltaTry-PA 253 CG12351-PA 5..132 9..130 207 37.2 Plus
CG30031-PA 253 CG30031-PA 5..132 9..130 207 37.2 Plus