Clone BS28349 Report

Search the DGRC for BS28349

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:283
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG18649-RA
Protein status:BS28349.pep: gold
Sequenced Size:311

Clone Sequence Records

BS28349.complete Sequence

311 bp assembled on 2012-03-08

GenBank Submission: KX801548

> BS28349.complete
GAAGTTATCAGTCGACATGCGTGCCTATTTGCTGCTTGCCCTGTTTGGAT
GTGTGCTTTTGGCCACAGTTTCCGCAAATCCGGTGGACATTGACGACTTG
GAGGACCTCGAGGAGGACAAACGAATTGCTGATGAGCAGGATAATGCTAA
CGATGATGAGAAAGACGATGAGGATTCAAATGAACCCGAGTCCGACGACG
ACTTAGATGAGCCTGAATCCCCGGAGGACGATTCCCAGAACAATGATGAT
TCCGAAAGCGACGAGAGCATCCAGTACAATCAAGATGAAGAGTAGAAGCT
TTCTAGACCAT

BS28349.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 07:52:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG18649-RB 279 CG18649-PB 1..279 17..295 1395 100 Plus
CG18649-RA 279 CG18649-PA 1..279 17..295 1395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 07:52:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG18649-RB 568 CG18649-RB 33..311 17..295 1395 100 Plus
CG18649-RA 489 CG18649-RA 33..311 17..295 1395 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 07:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15053825..15054103 295..17 1395 100 Minus
Blast to na_te.dros performed on 2014-11-28 07:52:09 has no hits.

BS28349.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-08 17:47:37 Download gff for BS28349.complete
Subject Subject Range Query Range Percent Splice Strand
CG18649-RA 31..309 17..295 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:46 Download gff for BS28349.complete
Subject Subject Range Query Range Percent Splice Strand
CG18649-RA 33..311 17..295 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:05:35 Download gff for BS28349.complete
Subject Subject Range Query Range Percent Splice Strand
CG18649-RA 33..311 17..295 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:05:35 Download gff for BS28349.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15053825..15054103 17..295 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:46 Download gff for BS28349.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15046925..15047203 17..295 100   Minus

BS28349.pep Sequence

Translation from 16 to 294

> BS28349.pep
MRAYLLLALFGCVLLATVSANPVDIDDLEDLEEDKRIADEQDNANDDEKD
DEDSNEPESDDDLDEPESPEDDSQNNDDSESDESIQYNQDEE*

BS28349.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG18649-PB 92 CG18649-PB 1..92 1..92 478 100 Plus
CG18649-PA 92 CG18649-PA 1..92 1..92 478 100 Plus
l(2)01289-PG 1191 CG9432-PG 828..899 21..92 149 38.9 Plus
l(2)01289-PM 1193 CG9432-PM 828..899 21..92 149 38.9 Plus