Clone BS28352 Report

Search the DGRC for BS28352

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:283
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCG42455-RA
Protein status:BS28352.pep: full length peptide match
Sequenced Size:269

Clone Sequence Records

BS28352.complete Sequence

269 bp assembled on 2012-03-08

GenBank Submission: KX802067

> BS28352.complete
GAAGTTATCAGTCGACATGTCCCTGCAAACGGGCTTGGCTTTCATTTTCA
CCATATTAGCCTCTGTTAGTATCGTCGCAGCAATTATTTTGTTGGGCTGG
TTCCTCATCTGGAAGGCGTTTCTATCGAAATTTCGTCTGGTTCGAGAGCT
GTTGGGTCAGGAGGAGCCGGAGGATCAGCAACCACTTGCTTGGGATCATC
AGAATCAACAGCCACACCACCACGGCAGAGCCAGGAAAGCTCGCCGAGAC
TAGAAGCTTTCTAGACCAT

BS28352.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 07:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG42455-RC 237 CG42455-PC 1..237 17..253 1185 100 Plus
CG42455-RB 237 CG42455-PB 1..237 17..253 1185 100 Plus
CG42455-RA 237 CG42455-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 07:56:04
Subject Length Description Subject Range Query Range Score Percent Strand
vnc-RC 1137 CG11989-RC 129..365 17..253 1185 100 Plus
vnc-RD 1176 CG11989-RD 168..404 17..253 1185 100 Plus
vnc-RA 1096 CG11989-RA 88..324 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 07:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9973093..9973251 95..253 795 100 Plus
3L 28110227 3L 9972923..9973002 17..96 400 100 Plus
Blast to na_te.dros performed on 2014-11-28 07:56:02 has no hits.

BS28352.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-08 17:47:38 Download gff for BS28352.complete
Subject Subject Range Query Range Percent Splice Strand
CG42455-RB 157..393 17..253 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:53 Download gff for BS28352.complete
Subject Subject Range Query Range Percent Splice Strand
vnc-RA 88..324 17..253 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:07:18 Download gff for BS28352.complete
Subject Subject Range Query Range Percent Splice Strand
vnc-RA 88..324 17..253 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:07:18 Download gff for BS28352.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9972923..9973001 17..95 100 -> Plus
3L 9973094..9973251 96..253 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:53 Download gff for BS28352.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9966023..9966101 17..95 100 -> Plus
arm_3L 9966194..9966351 96..253 100   Plus

BS28352.pep Sequence

Translation from 16 to 252

> BS28352.pep
MSLQTGLAFIFTILASVSIVAAIILLGWFLIWKAFLSKFRLVRELLGQEE
PEDQQPLAWDHQNQQPHHHGRARKARRD*

BS28352.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:51:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG42455-PC 78 CG42455-PC 1..78 1..78 407 100 Plus
CG42455-PB 78 CG42455-PB 1..78 1..78 407 100 Plus
CG42455-PA 78 CG42455-PA 1..78 1..78 407 100 Plus