BS28358.complete Sequence
218 bp assembled on 2012-03-08
GenBank Submission: KX801554
> BS28358.complete
GAAGTTATCAGTCGACATGGAGCGTCTATTGATCAACACGATATGGCGCT
CCTACGCAACAAAATTAACTGGGTCCCAGGTGAAGTTAATGGCGCGGGGA
TTGCCTAAAAAGCAACCGATTATTGGAGTACAAGATATTATAGTCGTTGC
CTCTGGAAAGGGTGGTGTTGGAAAAAGCACCGTGGCAGCTTGGCAAAACT
AGAAGCTTTCTAGACCAT
BS28358.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 07:49:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3262-RE | 882 | CG3262-PE | 1..172 | 17..188 | 860 | 100 | Plus |
CG3262-RD | 882 | CG3262-PD | 1..172 | 17..188 | 860 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 07:49:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3262-RF | 900 | CG3262-RF | 17..202 | 17..202 | 930 | 100 | Plus |
CG3262-RE | 7023 | CG3262-RE | 17..188 | 17..188 | 860 | 100 | Plus |
CG3262-RD | 1013 | CG3262-RD | 17..188 | 17..188 | 860 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 07:49:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 22239932..22240103 | 17..188 | 860 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 07:49:49 has no hits.
BS28358.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-08 17:47:35 Download gff for
BS28358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3262-RC | 27..212 | 17..202 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:32 Download gff for
BS28358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3262-RF | 17..202 | 17..202 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:04:47 Download gff for
BS28358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3262-RF | 17..202 | 17..202 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:04:47 Download gff for
BS28358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 22239932..22240103 | 17..188 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:32 Download gff for
BS28358.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 22239932..22240103 | 17..188 | 100 | -> | Plus |
BS28358.pep Sequence
Translation from 16 to 201
> BS28358.pep
MERLLINTIWRSYATKLTGSQVKLMARGLPKKQPIIGVQDIIVVASGKGG
VGKSTVAAWQN*
BS28358.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:51:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3262-PE | 293 | CG3262-PE | 1..57 | 1..57 | 281 | 100 | Plus |
CG3262-PD | 293 | CG3262-PD | 1..57 | 1..57 | 281 | 100 | Plus |