Clone BS28358 Report

Search the DGRC for BS28358

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:283
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG3262-RC
Protein status:BS28358.pep: full length peptide match
Sequenced Size:218

Clone Sequence Records

BS28358.complete Sequence

218 bp assembled on 2012-03-08

GenBank Submission: KX801554

> BS28358.complete
GAAGTTATCAGTCGACATGGAGCGTCTATTGATCAACACGATATGGCGCT
CCTACGCAACAAAATTAACTGGGTCCCAGGTGAAGTTAATGGCGCGGGGA
TTGCCTAAAAAGCAACCGATTATTGGAGTACAAGATATTATAGTCGTTGC
CTCTGGAAAGGGTGGTGTTGGAAAAAGCACCGTGGCAGCTTGGCAAAACT
AGAAGCTTTCTAGACCAT

BS28358.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 07:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG3262-RE 882 CG3262-PE 1..172 17..188 860 100 Plus
CG3262-RD 882 CG3262-PD 1..172 17..188 860 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 07:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG3262-RF 900 CG3262-RF 17..202 17..202 930 100 Plus
CG3262-RE 7023 CG3262-RE 17..188 17..188 860 100 Plus
CG3262-RD 1013 CG3262-RD 17..188 17..188 860 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 07:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22239932..22240103 17..188 860 100 Plus
Blast to na_te.dros performed on 2014-11-28 07:49:49 has no hits.

BS28358.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-08 17:47:35 Download gff for BS28358.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RC 27..212 17..202 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:32 Download gff for BS28358.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RF 17..202 17..202 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:04:47 Download gff for BS28358.complete
Subject Subject Range Query Range Percent Splice Strand
CG3262-RF 17..202 17..202 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:04:47 Download gff for BS28358.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22239932..22240103 17..188 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:32 Download gff for BS28358.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22239932..22240103 17..188 100 -> Plus

BS28358.pep Sequence

Translation from 16 to 201

> BS28358.pep
MERLLINTIWRSYATKLTGSQVKLMARGLPKKQPIIGVQDIIVVASGKGG
VGKSTVAAWQN*

BS28358.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG3262-PE 293 CG3262-PE 1..57 1..57 281 100 Plus
CG3262-PD 293 CG3262-PD 1..57 1..57 281 100 Plus