Clone BS28362 Report

Search the DGRC for BS28362

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:283
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptCG31808-RC
Protein status:BS28362.pep: full length peptide match
Sequenced Size:203

Clone Sequence Records

BS28362.complete Sequence

203 bp assembled on 2012-03-08

GenBank Submission: KX805784

> BS28362.complete
GAAGTTATCAGTCGACATGAAGATGAGCTCGCCCAGGATCATGCAGCAGA
AACGGAGCAGCAAGTCCTCCAATTCGTCGCGGGTCTCCATGACCACCTCG
ACGGCGGAGGAGAATCTCATAGAATCGAAGCTCTTCAGCTGGATGCGTCT
ATTCCGATTCGCCTCGCTGCTCTGCCGCGCCGAGTAAAAGCTTTCTAGAC
CAT

BS28362.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG31808-RC 171 CG31808-PC 1..171 17..187 855 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG31808-RC 1929 CG31808-RC 523..693 17..187 855 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16705522..16705692 187..17 855 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:04:46 has no hits.

BS28362.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-08 17:47:43 Download gff for BS28362.complete
Subject Subject Range Query Range Percent Splice Strand
CG31808-RC 519..687 17..185 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:34:23 Download gff for BS28362.complete
Subject Subject Range Query Range Percent Splice Strand
CG31808-RC 523..691 17..185 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:10:19 Download gff for BS28362.complete
Subject Subject Range Query Range Percent Splice Strand
CG31808-RC 523..691 17..185 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:10:19 Download gff for BS28362.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16705524..16705692 17..185 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:34:23 Download gff for BS28362.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16705524..16705692 17..185 100   Minus

BS28362.pep Sequence

Translation from 16 to 186

> BS28362.pep
MKMSSPRIMQQKRSSKSSNSSRVSMTTSTAEENLIESKLFSWMRLFRFAS
LLCRAE*

BS28362.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG31808-PC 56 CG31808-PC 1..56 1..56 273 100 Plus