BS28362.complete Sequence
203 bp assembled on 2012-03-08
GenBank Submission: KX805784
> BS28362.complete
GAAGTTATCAGTCGACATGAAGATGAGCTCGCCCAGGATCATGCAGCAGA
AACGGAGCAGCAAGTCCTCCAATTCGTCGCGGGTCTCCATGACCACCTCG
ACGGCGGAGGAGAATCTCATAGAATCGAAGCTCTTCAGCTGGATGCGTCT
ATTCCGATTCGCCTCGCTGCTCTGCCGCGCCGAGTAAAAGCTTTCTAGAC
CAT
BS28362.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:04:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31808-RC | 171 | CG31808-PC | 1..171 | 17..187 | 855 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:04:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31808-RC | 1929 | CG31808-RC | 523..693 | 17..187 | 855 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:04:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 16705522..16705692 | 187..17 | 855 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 08:04:46 has no hits.
BS28362.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-08 17:47:43 Download gff for
BS28362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31808-RC | 519..687 | 17..185 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:34:23 Download gff for
BS28362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31808-RC | 523..691 | 17..185 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:10:19 Download gff for
BS28362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31808-RC | 523..691 | 17..185 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:10:19 Download gff for
BS28362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16705524..16705692 | 17..185 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:34:23 Download gff for
BS28362.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 16705524..16705692 | 17..185 | 100 | | Minus |
BS28362.pep Sequence
Translation from 16 to 186
> BS28362.pep
MKMSSPRIMQQKRSSKSSNSSRVSMTTSTAEENLIESKLFSWMRLFRFAS
LLCRAE*
BS28362.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:51:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31808-PC | 56 | CG31808-PC | 1..56 | 1..56 | 273 | 100 | Plus |