BS28370.complete Sequence
440 bp assembled on 2012-03-08
GenBank Submission: KX802979
> BS28370.complete
GAAGTTATCAGTCGACATGAAATTCGCCGTCGCCGTTATCTTCACCTTGG
CCCTCGCCATGGGCGTGCAGTCGTCTGTGATCCCCCTGCTGTCCCAGGTG
GCTGGACATGGACTGTCCTACACCGCCGTTTCCGGACCCGCTGTGGTGGC
CTCTCCCTGGGCCGTTCCCGCCGCCCACTGGCCTGCTGCCGTGAACGTGG
CTTCGTGGCCTCCGGCAGCGATCCACGCCGCCGCTCCTGCCGTGCTTGCT
GCCCCTGCTCCCGCTGTGGTTGCTGCTCATGCTCCCTCAGTCGTCGTGGC
CCCAGTGGCTCACAGTGGCGTCTACACTGCCCAGACCCGTGGTGCCATTC
ACACCGCTCCTCTGGCCGGACACATCCAGTCGGTGGCCTCCATCAATGCC
GCTCCCGCACCCGGAACCTTGTAAAAGCTTTCTAGACCAT
BS28370.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:02:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp1-RA | 408 | CG7216-PA | 1..408 | 17..424 | 2040 | 100 | Plus |
CG31904-RB | 1212 | CG31904-PB | 670..1060 | 23..424 | 1810 | 97.3 | Plus |
CG31904-RD | 1212 | CG31904-PD | 670..1060 | 23..424 | 1810 | 97.3 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:02:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp1-RA | 858 | CG7216-RA | 56..464 | 16..424 | 2045 | 100 | Plus |
CG31904-RB | 3572 | CG31904-RB | 2781..3171 | 23..424 | 1810 | 97.3 | Plus |
CG31904-RD | 1943 | CG31904-RD | 1152..1542 | 23..424 | 1810 | 97.3 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:02:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 7740956..7741357 | 424..23 | 2010 | 100 | Minus |
2L | 23513712 | 2L | 7734816..7735206 | 424..23 | 1810 | 97.3 | Minus |
2L | 23513712 | 2L | 7744256..7744303 | 376..329 | 180 | 91.7 | Minus |
Blast to na_te.dros performed on 2014-11-28 08:02:07 has no hits.
BS28370.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-08 17:47:40 Download gff for
BS28370.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp1-RA | 62..467 | 17..422 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:34:07 Download gff for
BS28370.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp1-RA | 57..462 | 17..422 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:09:30 Download gff for
BS28370.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp1-RA | 57..462 | 17..422 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:09:30 Download gff for
BS28370.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7740958..7741363 | 17..422 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:34:07 Download gff for
BS28370.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 7740958..7741363 | 17..422 | 99 | | Minus |
BS28370.pep Sequence
Translation from 16 to 423
> BS28370.pep
MKFAVAVIFTLALAMGVQSSVIPLLSQVAGHGLSYTAVSGPAVVASPWAV
PAAHWPAAVNVASWPPAAIHAAAPAVLAAPAPAVVAAHAPSVVVAPVAHS
GVYTAQTRGAIHTAPLAGHIQSVASINAAPAPGTL*
BS28370.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:51:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp1-PA | 135 | CG7216-PA | 1..135 | 1..135 | 678 | 100 | Plus |
CG31904-PB | 403 | CG31904-PB | 224..341 | 3..120 | 596 | 100 | Plus |
CG31904-PD | 403 | CG31904-PD | 224..341 | 3..120 | 596 | 100 | Plus |
CG7203-PC | 129 | CG7203-PC | 1..128 | 1..134 | 276 | 52.9 | Plus |
CG7203-PB | 129 | CG7203-PB | 1..128 | 1..134 | 276 | 52.9 | Plus |