Clone BS28378 Report

Search the DGRC for BS28378

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:283
Well:78
Vector:pDNR-Dual
Associated Gene/TranscriptFK506-bp2-RA
Protein status:BS28378.pep: full length peptide match
Sequenced Size:359

Clone Sequence Records

BS28378.complete Sequence

359 bp assembled on 2012-03-08

GenBank Submission: KX802052

> BS28378.complete
GAAGTTATCAGTCGACATGGGCGTACAAGTAGTTCCAATTGCTCCTGGTG
ATGGCAGCACCTATCCCAAGAATGGCCAAAAGGTCACGGTCCACTACACC
GGCACCCTGGACGATGGCACCAAGTTCGATTCGTCGCGCGACCGCAACAA
GCCATTCAAGTTCACCATCGGCAAGGGCGAGGTCATCCGTGGCTGGGATG
AGGGAGTTGCCCAGTTGAGCGTCGGCCAGCGCGCCAAGCTGATTTGCTCG
CCGGACTATGCCTACGGTAGCCGTGGCCACCCCGGCGTCATTCCGCCCAA
CTCCACCCTCACCTTCGACGTCGAGCTGCTCAAGGTCGAATAGAAGCTTT
CTAGACCAT

BS28378.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:17:28
Subject Length Description Subject Range Query Range Score Percent Strand
FK506-bp2-RA 327 CG11001-PA 1..327 17..343 1635 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:17:29
Subject Length Description Subject Range Query Range Score Percent Strand
FK506-bp2-RA 633 CG11001-RA 76..407 12..343 1645 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19290516..19290736 123..343 1105 100 Plus
2R 25286936 2R 19290385..19290456 53..124 360 100 Plus
2R 25286936 2R 19290184..19290226 12..54 200 97.7 Plus
Blast to na_te.dros performed on 2014-11-28 08:17:27 has no hits.

BS28378.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-08 17:47:51 Download gff for BS28378.complete
Subject Subject Range Query Range Percent Splice Strand
FK506-bp2-RA 85..411 17..343 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:35:07 Download gff for BS28378.complete
Subject Subject Range Query Range Percent Splice Strand
FK506-bp2-RA 81..407 17..343 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:14:48 Download gff for BS28378.complete
Subject Subject Range Query Range Percent Splice Strand
FK506-bp2-RA 81..407 17..343 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:14:48 Download gff for BS28378.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19290189..19290225 17..53 100 -> Plus
2R 19290386..19290456 54..124 100 -> Plus
2R 19290518..19290736 125..343 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:35:07 Download gff for BS28378.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15177694..15177730 17..53 100 -> Plus
arm_2R 15177891..15177961 54..124 100 -> Plus
arm_2R 15178023..15178241 125..343 100   Plus

BS28378.pep Sequence

Translation from 16 to 342

> BS28378.pep
MGVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFT
IGKGEVIRGWDEGVAQLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTF
DVELLKVE*

BS28378.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
FK506-bp2-PA 108 CG11001-PA 1..108 1..108 576 100 Plus
FKBP59-PB 439 CG4535-PB 14..117 2..105 283 50 Plus
FKBP59-PA 439 CG4535-PA 14..117 2..105 283 50 Plus
Fkbp14-PF 216 CG9847-PF 42..132 18..107 269 53.8 Plus
Fkbp14-PE 216 CG9847-PE 42..132 18..107 269 53.8 Plus