BS28378.complete Sequence
359 bp assembled on 2012-03-08
GenBank Submission: KX802052
> BS28378.complete
GAAGTTATCAGTCGACATGGGCGTACAAGTAGTTCCAATTGCTCCTGGTG
ATGGCAGCACCTATCCCAAGAATGGCCAAAAGGTCACGGTCCACTACACC
GGCACCCTGGACGATGGCACCAAGTTCGATTCGTCGCGCGACCGCAACAA
GCCATTCAAGTTCACCATCGGCAAGGGCGAGGTCATCCGTGGCTGGGATG
AGGGAGTTGCCCAGTTGAGCGTCGGCCAGCGCGCCAAGCTGATTTGCTCG
CCGGACTATGCCTACGGTAGCCGTGGCCACCCCGGCGTCATTCCGCCCAA
CTCCACCCTCACCTTCGACGTCGAGCTGCTCAAGGTCGAATAGAAGCTTT
CTAGACCAT
BS28378.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:17:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
FK506-bp2-RA | 327 | CG11001-PA | 1..327 | 17..343 | 1635 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:17:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
FK506-bp2-RA | 633 | CG11001-RA | 76..407 | 12..343 | 1645 | 99.7 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:17:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 19290516..19290736 | 123..343 | 1105 | 100 | Plus |
2R | 25286936 | 2R | 19290385..19290456 | 53..124 | 360 | 100 | Plus |
2R | 25286936 | 2R | 19290184..19290226 | 12..54 | 200 | 97.7 | Plus |
Blast to na_te.dros performed on 2014-11-28 08:17:27 has no hits.
BS28378.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-08 17:47:51 Download gff for
BS28378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
FK506-bp2-RA | 85..411 | 17..343 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:35:07 Download gff for
BS28378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
FK506-bp2-RA | 81..407 | 17..343 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:14:48 Download gff for
BS28378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
FK506-bp2-RA | 81..407 | 17..343 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:14:48 Download gff for
BS28378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19290189..19290225 | 17..53 | 100 | -> | Plus |
2R | 19290386..19290456 | 54..124 | 100 | -> | Plus |
2R | 19290518..19290736 | 125..343 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:35:07 Download gff for
BS28378.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 15177694..15177730 | 17..53 | 100 | -> | Plus |
arm_2R | 15177891..15177961 | 54..124 | 100 | -> | Plus |
arm_2R | 15178023..15178241 | 125..343 | 100 | | Plus |
BS28378.pep Sequence
Translation from 16 to 342
> BS28378.pep
MGVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFT
IGKGEVIRGWDEGVAQLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTF
DVELLKVE*
BS28378.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:51:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
FK506-bp2-PA | 108 | CG11001-PA | 1..108 | 1..108 | 576 | 100 | Plus |
FKBP59-PB | 439 | CG4535-PB | 14..117 | 2..105 | 283 | 50 | Plus |
FKBP59-PA | 439 | CG4535-PA | 14..117 | 2..105 | 283 | 50 | Plus |
Fkbp14-PF | 216 | CG9847-PF | 42..132 | 18..107 | 269 | 53.8 | Plus |
Fkbp14-PE | 216 | CG9847-PE | 42..132 | 18..107 | 269 | 53.8 | Plus |