Clone BS28392 Report

Search the DGRC for BS28392

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:283
Well:92
Vector:pDNR-Dual
Associated Gene/TranscriptObp18a-RA
Protein status:BS28392.pep: gold
Sequenced Size:419

Clone Sequence Records

BS28392.complete Sequence

419 bp assembled on 2012-03-08

GenBank Submission: KX803247

> BS28392.complete
GAAGTTATCAGTCGACATGAAGGTTGTGTGCAGCATAGCTGTACTATGGA
TTTGCTTGATAACTATGTGGCAATCAGCTGGCCGCGTTAACGCAGAGGGT
TGCCTAAAGCACCACAATCTGACCAGTGCCCAAGTGCAGGCAGTGGCTCC
ATCCACTCCCGTTGCGGATGTTCCAGTGGCCGTTAAGTGCTATAGCCGGT
GTCTGATCCAGGATTATTTCGGTGATGATGGGAAAATCGATCTGCAGAAG
GTGGGAAAGCGAGGATCTCAAGAGGACCACGTGATTTTGTCCCAGTGTAA
GCAGCAGTTCGATGGCGTCACCAATCTGGACACGTGCGACTATCCATACC
TGATTCTCCAGTGTTATTTTAAGGGCAAGCAGAGTGGAACTATCGCCTCG
TAAAAGCTTTCTAGACCAT

BS28392.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:24:55
Subject Length Description Subject Range Query Range Score Percent Strand
Obp18a-RA 387 CG15883-PA 1..387 17..403 1935 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
Obp18a-RA 734 CG15883-RA 21..412 12..403 1945 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19135403..19135739 403..67 1685 100 Minus
X 23542271 X 19135793..19135848 67..12 265 98.2 Minus
Blast to na_te.dros performed on 2014-11-28 08:24:54 has no hits.

BS28392.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-08 17:47:57 Download gff for BS28392.complete
Subject Subject Range Query Range Percent Splice Strand
Obp18a-RA 26..410 17..401 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:35:36 Download gff for BS28392.complete
Subject Subject Range Query Range Percent Splice Strand
Obp18a-RA 26..410 17..401 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:17:41 Download gff for BS28392.complete
Subject Subject Range Query Range Percent Splice Strand
Obp18a-RA 26..410 17..401 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:17:41 Download gff for BS28392.complete
Subject Subject Range Query Range Percent Splice Strand
X 19135405..19135738 68..401 100 <- Minus
X 19135793..19135843 17..67 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:35:36 Download gff for BS28392.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19029438..19029771 68..401 100 <- Minus
arm_X 19029826..19029876 17..67 100   Minus

BS28392.pep Sequence

Translation from 16 to 402

> BS28392.pep
MKVVCSIAVLWICLITMWQSAGRVNAEGCLKHHNLTSAQVQAVAPSTPVA
DVPVAVKCYSRCLIQDYFGDDGKIDLQKVGKRGSQEDHVILSQCKQQFDG
VTNLDTCDYPYLILQCYFKGKQSGTIAS*

BS28392.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:52:13
Subject Length Description Subject Range Query Range Score Percent Strand
Obp18a-PA 128 CG15883-PA 1..128 1..128 686 100 Plus