Clone BS28502 Report

Search the DGRC for BS28502

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:285
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG43071-RB
Protein status:BS28502.pep: full length peptide match
Sequenced Size:218

Clone Sequence Records

BS28502.complete Sequence

218 bp assembled on 2012-03-26

GenBank Submission: KX801338

> BS28502.complete
GAAGTTATCAGTCGACATGTTGTTACAATCGATATTAATGAAAATATTGG
CCGTTTTTTTGGTCTGCTGGCTGGGACACGTCACAGCCCAGTCATCTGCC
GATTATATAGAGCTTGAAATTGGTTCAAGGGGTGAAGGTCCACCGGAAAA
GACGGAATTTCCCTGGGGCAATGATGACCAGGATCTTGAAGCAACATTTT
AAAAGCTTTCTAGACCAT

BS28502.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG43071-RC 186 CG43071-PC 1..186 17..202 930 100 Plus
CG43071-RB 186 CG43071-PB 1..186 17..202 930 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG43071-RC 514 CG43071-RC 26..211 17..202 930 100 Plus
CG43071-RB 316 CG43071-RB 26..211 17..202 930 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18864924..18865056 202..70 665 100 Minus
2R 25286936 2R 18865140..18865193 70..17 270 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:07:11 has no hits.

BS28502.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:00 Download gff for BS28502.complete
Subject Subject Range Query Range Percent Splice Strand
CG43071-RA 1..163 38..200 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:10:19 Download gff for BS28502.complete
Subject Subject Range Query Range Percent Splice Strand
CG43071-RB 31..209 22..200 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:06 Download gff for BS28502.complete
Subject Subject Range Query Range Percent Splice Strand
CG43071-RB 31..209 22..200 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:06 Download gff for BS28502.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18864926..18865055 71..200 100 <- Minus
2R 18865140..18865188 22..70 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:10:19 Download gff for BS28502.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14752431..14752560 71..200 100 <- Minus
arm_2R 14752645..14752693 22..70 100   Minus

BS28502.pep Sequence

Translation from 16 to 201

> BS28502.pep
MLLQSILMKILAVFLVCWLGHVTAQSSADYIELEIGSRGEGPPEKTEFPW
GNDDQDLEATF*

BS28502.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:59:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG43071-PC 61 CG43071-PC 1..61 1..61 322 100 Plus
CG43071-PB 61 CG43071-PB 1..61 1..61 322 100 Plus