Clone BS28508 Report

Search the DGRC for BS28508

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:285
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptCG42787-RA
Protein status:BS28508.pep: gold
Sequenced Size:281

Clone Sequence Records

BS28508.complete Sequence

281 bp assembled on 2012-03-26

GenBank Submission: KX803854

> BS28508.complete
GAAGTTATCAGTCGACATGTCAGAACAACCGACACAACATAAATCCGACG
ATCGCTTCACTATCCTGCAAACCTTATCGGATGTAGTGGACTCTGGTCTC
AGCAAGGAAGCCCTTAAAATCTGCATCGAACTGGTGGACAATGGTGTCTG
TGGTGGAGCACTAGCACATGTAATTCGAACCATTAGAGAGGAGATTCAAG
ATGATGAAGATAAGGAAAGTGATGATTCCGGAGAATCGGCTGCATCAACA
GACTCAACTTTGTAGAAGCTTTCTAGACCAT

BS28508.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:07:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG42787-RA 249 CG42787-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG42787-RA 386 CG42787-RA 72..320 17..265 1245 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2389336..2389584 17..265 1245 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:07:28 has no hits.

BS28508.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:04 Download gff for BS28508.complete
Subject Subject Range Query Range Percent Splice Strand
CG42787-RA 1..249 17..265 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:10:29 Download gff for BS28508.complete
Subject Subject Range Query Range Percent Splice Strand
CG42787-RA 72..320 17..265 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:15 Download gff for BS28508.complete
Subject Subject Range Query Range Percent Splice Strand
CG42787-RA 72..320 17..265 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:15 Download gff for BS28508.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2389336..2389584 17..265 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:10:29 Download gff for BS28508.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2389336..2389584 17..265 100   Plus

BS28508.pep Sequence

Translation from 16 to 264

> BS28508.pep
MSEQPTQHKSDDRFTILQTLSDVVDSGLSKEALKICIELVDNGVCGGALA
HVIRTIREEIQDDEDKESDDSGESAASTDSTL*

BS28508.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG42787-PA 82 CG42787-PA 1..82 1..82 411 100 Plus