Clone BS28513 Report

Search the DGRC for BS28513

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:285
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptCG42634-RA
Protein status:BS28513.pep: full length peptide match
Sequenced Size:377

Clone Sequence Records

BS28513.complete Sequence

377 bp assembled on 2012-03-26

GenBank Submission: KX803863

> BS28513.complete
GAAGTTATCAGTCGACATGTCCTCGTCTGTGGATCACGTGGTACACCACG
TACTGGCCCCAATGGCAATCAACGTCCTCGATCGCGTGGTGCCAGTAATC
CGCCAATTGGTGATCATCATGCATCAGGCATTTCTGGTTGATCACCATGT
GTCGGAGCCCGTGATCGATGTATCCGGCATGATTCAGCCCGTTCGTAAAA
TAGTCTTGATTGTAAACGATTCAACGCCGGAGCACCATGTCGACCAGGAG
CAGGTGGTCAGTTCGGATGACATTAACTACCTGATAAATGAAATTTCGCG
AAGTATCCGAAACTTGGCCCGTTCGACCTATAATACCATCTCGGCGATGG
CTGGAGAGTAGAAGCTTTCTAGACCAT

BS28513.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG42634-RA 345 CG42634-PA 1..345 17..361 1725 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG42635-RA 1028 CG42635-RA 59..404 16..361 1730 100 Plus
CG42634-RA 1028 CG42634-RA 59..404 16..361 1730 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:07:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18007993..18008338 16..361 1730 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:07:35 has no hits.

BS28513.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:05 Download gff for BS28513.complete
Subject Subject Range Query Range Percent Splice Strand
CG42635-RA 60..404 17..361 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:10:33 Download gff for BS28513.complete
Subject Subject Range Query Range Percent Splice Strand
CG42635-RA 60..404 17..361 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:18 Download gff for BS28513.complete
Subject Subject Range Query Range Percent Splice Strand
CG42634-RA 60..404 17..361 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:18 Download gff for BS28513.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18007994..18008338 17..361 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:10:33 Download gff for BS28513.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18007994..18008338 17..361 100   Plus

BS28513.pep Sequence

Translation from 16 to 360

> BS28513.pep
MSSSVDHVVHHVLAPMAINVLDRVVPVIRQLVIIMHQAFLVDHHVSEPVI
DVSGMIQPVRKIVLIVNDSTPEHHVDQEQVVSSDDINYLINEISRSIRNL
ARSTYNTISAMAGE*

BS28513.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:00:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG42634-PA 114 CG42634-PA 1..114 1..114 568 100 Plus