Clone BS28514 Report

Search the DGRC for BS28514

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:285
Well:14
Vector:pDNR-Dual
Associated Gene/TranscriptCG43072-RA
Protein status:BS28514.pep: full length peptide match
Sequenced Size:281

Clone Sequence Records

BS28514.complete Sequence

281 bp assembled on 2012-03-26

GenBank Submission: KX801340

> BS28514.complete
GAAGTTATCAGTCGACATGACCATGGAACTGCTTGCGCGGCACAATCTTC
AGAAGGTTGAACAGCTCACGACCTTCGATCTGAAATATTTCTTTATCATC
TACGCCATCGTCGTCCTGATGATCCTGGGTGTTCCACTGGCCTTCCTACT
TCAAAGCAAGGGTTCGGCGAACGAAAGGGATCGTTTTCAATTGGAAGCCA
ATCGATCGCGCGTGGATCCAGTGAGGGGAGAAACCCGGCGACGAATCCGG
GATTCGAGTGCCTAAAAGCTTTCTAGACCAT

BS28514.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG43072-RA 249 CG43072-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG43072-RA 387 CG43072-RA 87..335 17..265 1245 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21065938..21066186 17..265 1245 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:07:38 has no hits.

BS28514.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:06 Download gff for BS28514.complete
Subject Subject Range Query Range Percent Splice Strand
CG43072-RA 1..247 17..263 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:10:35 Download gff for BS28514.complete
Subject Subject Range Query Range Percent Splice Strand
CG43072-RA 87..333 17..263 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:20 Download gff for BS28514.complete
Subject Subject Range Query Range Percent Splice Strand
CG43072-RA 87..333 17..263 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:20 Download gff for BS28514.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21065938..21066184 17..263 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:10:35 Download gff for BS28514.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21059038..21059284 17..263 100   Plus

BS28514.pep Sequence

Translation from 16 to 264

> BS28514.pep
MTMELLARHNLQKVEQLTTFDLKYFFIIYAIVVLMILGVPLAFLLQSKGS
ANERDRFQLEANRSRVDPVRGETRRRIRDSSA*

BS28514.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG43072-PA 82 CG43072-PA 1..82 1..82 403 100 Plus