Clone BS28515 Report

Search the DGRC for BS28515

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:285
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptCG13069-RA
Protein status:BS28515.pep: gold
Sequenced Size:326

Clone Sequence Records

BS28515.complete Sequence

326 bp assembled on 2012-03-26

GenBank Submission: KX802050

> BS28515.complete
GAAGTTATCAGTCGACATGTTCAAGTTCTTCGCCGTCGCCCTCTTCGCAC
TGATTGCCTGCGTGGCCGCCAAGCCCGGAATCGTGGCTCCTCTGGCCTAC
TCCGCACCTCTGGTGGCTGCTGCTCCGGCGGCTGCGGTTTACAGCCGGGA
ATACCACGGAAATTTTGCGGCTCCCTACGTGGCATCTCCCTATGTGGCTT
CTCCCTACGTGGCTTCTCCCTACGTCGCTTCCCCTTACGTGGCGTCTCCG
TATGTGGCATCTCCCTACGTTGCCGCCCCCTACACCGCTCCTCTGCTGCT
GAAGAAGTAGAAGCTTTCTAGACCAT

BS28515.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG13069-RA 294 CG13069-PA 1..294 17..310 1470 100 Plus
CG13051-RA 252 CG13051-PA 1..89 17..105 355 93.3 Plus
CG13051-RA 252 CG13051-PA 91..156 173..238 210 87.9 Plus
CG13051-RA 252 CG13051-PA 91..162 218..289 195 84.7 Plus
CG13051-RA 252 CG13051-PA 89..141 231..283 190 90.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG13069-RA 420 CG13069-RA 46..339 17..310 1470 100 Plus
CG13051-RA 388 CG13051-RA 36..124 17..105 355 93.3 Plus
CG13051-RA 388 CG13051-RA 126..191 173..238 210 87.9 Plus
CG13051-RA 388 CG13051-RA 126..197 218..289 195 84.7 Plus
CG13051-RA 388 CG13051-RA 124..176 231..283 190 90.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16265430..16265723 17..310 1470 100 Plus
3L 28110227 3L 16264977..16265065 105..17 355 93.3 Minus
3L 28110227 3L 16264910..16264975 238..173 210 87.9 Minus
3L 28110227 3L 16264904..16264975 289..218 195 84.7 Minus
3L 28110227 3L 16264925..16264977 283..231 190 90.6 Minus
Blast to na_te.dros performed on 2014-11-28 04:07:41 has no hits.

BS28515.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:06 Download gff for BS28515.complete
Subject Subject Range Query Range Percent Splice Strand
CG13069-RA 51..339 22..310 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:10:36 Download gff for BS28515.complete
Subject Subject Range Query Range Percent Splice Strand
CG13069-RA 51..339 22..310 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:22 Download gff for BS28515.complete
Subject Subject Range Query Range Percent Splice Strand
CG13069-RA 51..339 22..310 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:22 Download gff for BS28515.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16265435..16265723 22..310 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:10:36 Download gff for BS28515.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16258535..16258823 22..310 100   Plus

BS28515.pep Sequence

Translation from 16 to 309

> BS28515.pep
MFKFFAVALFALIACVAAKPGIVAPLAYSAPLVAAAPAAAVYSREYHGNF
AAPYVASPYVASPYVASPYVASPYVASPYVASPYVAAPYTAPLLLKK*

BS28515.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13069-PA 97 CG13069-PA 1..97 1..97 493 100 Plus
CG13051-PA 83 CG13051-PA 1..83 1..97 243 56.2 Plus
CG13067-PA 79 CG13067-PA 1..76 1..76 175 55 Plus
CG18294-PA 141 CG18294-PA 1..111 1..96 172 45.3 Plus
CG12519-PB 131 CG12519-PB 1..108 1..93 166 45.6 Plus