Clone BS28526 Report

Search the DGRC for BS28526

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:285
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptCG42524-RA
Protein status:BS28526.pep: full length peptide match
Sequenced Size:290

Clone Sequence Records

BS28526.complete Sequence

290 bp assembled on 2012-03-26

GenBank Submission: KX806486

> BS28526.complete
GAAGTTATCAGTCGACATGATCGAAAACGATGGTGAGAGGGAGAGGGGTG
GAGAACCGGCGATAAGGAAGTGCGGATGTCTTTGGGCTCCTGCTTGGACT
TGGAAGATGGAAATCTTAATCCAAACGAATGGAAATGGAAGTCGAGAAGC
ACAGCCCACACGCACACAAACACATACACATAGAGAAGGACTTCTTGGGA
ACCAAGGTACTTCCGGAATGGATGGCCCGACTCCTGACTCCTCCTGGTCC
TGCCAGCTGGATCCTCCGGTCTGAAAGCTTTCTAGACCAT

BS28526.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG42524-RB 258 CG42524-PB 1..258 17..274 1290 100 Plus
CG42524-RA 258 CG42524-PA 1..258 17..274 1290 100 Plus
CG42524-RC 258 CG42524-PC 1..258 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG42524-RB 1881 CG42524-RB 1384..1647 12..275 1305 99.6 Plus
CG42524-RA 1984 CG42524-RA 1384..1647 12..275 1305 99.6 Plus
CG42524-RC 2167 CG42524-RC 1384..1647 12..275 1305 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15637758..15637888 145..275 655 100 Plus
2R 25286936 2R 15630709..15630780 75..146 360 100 Plus
2R 25286936 2R 15615237..15615300 12..75 305 98.4 Plus
Blast to na_te.dros performed on 2014-11-28 04:11:03 has no hits.

BS28526.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:42 Download gff for BS28526.complete
Subject Subject Range Query Range Percent Splice Strand
CG42524-RA 1141..1397 17..273 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:12:21 Download gff for BS28526.complete
Subject Subject Range Query Range Percent Splice Strand
CG42524-RC 1389..1645 17..273 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:21:47 Download gff for BS28526.complete
Subject Subject Range Query Range Percent Splice Strand
CG42524-RC 1389..1645 17..273 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:21:47 Download gff for BS28526.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15637760..15637886 147..273 100   Plus
2R 15615242..15615300 17..75 100 -> Plus
2R 15630710..15630780 76..146 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:12:21 Download gff for BS28526.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11502747..11502805 17..75 100 -> Plus
arm_2R 11518215..11518285 76..146 100 -> Plus
arm_2R 11525265..11525391 147..273 100   Plus

BS28526.pep Sequence

Translation from 16 to 273

> BS28526.pep
MIENDGERERGGEPAIRKCGCLWAPAWTWKMEILIQTNGNGSREAQPTRT
QTHTHREGLLGNQGTSGMDGPTPDSSWSCQLDPPV*

BS28526.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:04:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG42524-PB 85 CG42524-PB 1..85 1..85 481 100 Plus
CG42524-PA 85 CG42524-PA 1..85 1..85 481 100 Plus
CG42524-PC 85 CG42524-PC 1..85 1..85 481 100 Plus