BS28526.complete Sequence
290 bp assembled on 2012-03-26
GenBank Submission: KX806486
> BS28526.complete
GAAGTTATCAGTCGACATGATCGAAAACGATGGTGAGAGGGAGAGGGGTG
GAGAACCGGCGATAAGGAAGTGCGGATGTCTTTGGGCTCCTGCTTGGACT
TGGAAGATGGAAATCTTAATCCAAACGAATGGAAATGGAAGTCGAGAAGC
ACAGCCCACACGCACACAAACACATACACATAGAGAAGGACTTCTTGGGA
ACCAAGGTACTTCCGGAATGGATGGCCCGACTCCTGACTCCTCCTGGTCC
TGCCAGCTGGATCCTCCGGTCTGAAAGCTTTCTAGACCAT
BS28526.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:11:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42524-RB | 258 | CG42524-PB | 1..258 | 17..274 | 1290 | 100 | Plus |
CG42524-RA | 258 | CG42524-PA | 1..258 | 17..274 | 1290 | 100 | Plus |
CG42524-RC | 258 | CG42524-PC | 1..258 | 17..274 | 1290 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:11:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42524-RB | 1881 | CG42524-RB | 1384..1647 | 12..275 | 1305 | 99.6 | Plus |
CG42524-RA | 1984 | CG42524-RA | 1384..1647 | 12..275 | 1305 | 99.6 | Plus |
CG42524-RC | 2167 | CG42524-RC | 1384..1647 | 12..275 | 1305 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:11:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 15637758..15637888 | 145..275 | 655 | 100 | Plus |
2R | 25286936 | 2R | 15630709..15630780 | 75..146 | 360 | 100 | Plus |
2R | 25286936 | 2R | 15615237..15615300 | 12..75 | 305 | 98.4 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:11:03 has no hits.
BS28526.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:42 Download gff for
BS28526.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42524-RA | 1141..1397 | 17..273 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:12:21 Download gff for
BS28526.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42524-RC | 1389..1645 | 17..273 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:21:47 Download gff for
BS28526.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42524-RC | 1389..1645 | 17..273 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:21:47 Download gff for
BS28526.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 15637760..15637886 | 147..273 | 100 | | Plus |
2R | 15615242..15615300 | 17..75 | 100 | -> | Plus |
2R | 15630710..15630780 | 76..146 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:12:21 Download gff for
BS28526.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 11502747..11502805 | 17..75 | 100 | -> | Plus |
arm_2R | 11518215..11518285 | 76..146 | 100 | -> | Plus |
arm_2R | 11525265..11525391 | 147..273 | 100 | | Plus |
BS28526.pep Sequence
Translation from 16 to 273
> BS28526.pep
MIENDGERERGGEPAIRKCGCLWAPAWTWKMEILIQTNGNGSREAQPTRT
QTHTHREGLLGNQGTSGMDGPTPDSSWSCQLDPPV*
BS28526.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:04:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42524-PB | 85 | CG42524-PB | 1..85 | 1..85 | 481 | 100 | Plus |
CG42524-PA | 85 | CG42524-PA | 1..85 | 1..85 | 481 | 100 | Plus |
CG42524-PC | 85 | CG42524-PC | 1..85 | 1..85 | 481 | 100 | Plus |