Clone BS28532 Report

Search the DGRC for BS28532

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:285
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptCG13064-RA
Protein status:BS28532.pep: gold
Sequenced Size:296

Clone Sequence Records

BS28532.complete Sequence

296 bp assembled on 2012-03-26

GenBank Submission: KX805691

> BS28532.complete
GAAGTTATCAGTCGACATGTTCAAGCTCGTCGTGCTATTCGGCCTTTTGA
GTGGTGCCTTTGCCGCCACGGTTATCTACCATCACCCGGTGATCTATCAT
CATCCTCTGCCGGTTGCATCAACGCCCCAGGAGTTGGCTCAGCATCCTGG
CTACACCATTGTGGCACCTCTCACGAAGATTGCCCACGTCACCTACGATT
CGGTGCCCATTTCGCACACGCCCTACGAACATGTTCCTCTCTTCCAGAGG
ATTGGTCATGTCAAAAACATTAGGTTCTAGAAGCTTTCTAGACCAT

BS28532.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:08:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13064-RA 264 CG13064-PA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13064-RA 394 CG13064-RA 76..339 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16280549..16280805 24..280 1285 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:08:14 has no hits.

BS28532.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:12 Download gff for BS28532.complete
Subject Subject Range Query Range Percent Splice Strand
CG13064-RA 6..264 22..280 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:10:53 Download gff for BS28532.complete
Subject Subject Range Query Range Percent Splice Strand
CG13064-RA 81..339 22..280 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:35 Download gff for BS28532.complete
Subject Subject Range Query Range Percent Splice Strand
CG13064-RA 81..339 22..280 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:35 Download gff for BS28532.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16280547..16280805 22..280 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:10:53 Download gff for BS28532.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16273647..16273905 22..280 99   Plus

BS28532.pep Sequence

Translation from 16 to 279

> BS28532.pep
MFKLVVLFGLLSGAFAATVIYHHPVIYHHPLPVASTPQELAQHPGYTIVA
PLTKIAHVTYDSVPISHTPYEHVPLFQRIGHVKNIRF*

BS28532.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG13064-PA 87 CG13064-PA 1..87 1..87 465 100 Plus