Clone BS28535 Report

Search the DGRC for BS28535

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:285
Well:35
Vector:pDNR-Dual
Associated Gene/TranscriptCG17977-RA
Protein status:BS28535.pep: full length peptide match
Sequenced Size:311

Clone Sequence Records

BS28535.complete Sequence

311 bp assembled on 2012-03-26

GenBank Submission: KX804908

> BS28535.complete
GAAGTTATCAGTCGACATGACTTTTGCAAGGTGGAACTGGACTATTTTCC
CGTGTATGATCCCGACGAGCTTTCCAATCTGGATGCGAATCTTTCAAAGC
CGGGCAATAGCACAAAACGCTCATATTATTCACCGCATCCTGAGGCCAGA
AGGTCGAATAGAACCGCTGAAAAACAATTTGTCAAAGATGTTCAACTACG
ATATTCTCATGGCTTACAACTGCGACGGTGAGCTCTCAGTCAGCAGTCAG
TCATCTCATACAAATATATTAACGAAACTATTTTTGGGGTCCTGAAAGCT
TTCTAGACCAT

BS28535.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:08:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG17977-RA 279 CG17977-PA 1..279 17..295 1395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG17977-RA 966 CG17977-RA 212..492 17..297 1405 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:07:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8067125..8067293 287..119 845 100 Minus
2R 25286936 2R 8067342..8067444 119..17 515 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:07:59 has no hits.

BS28535.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:10 Download gff for BS28535.complete
Subject Subject Range Query Range Percent Splice Strand
CG17977-RA 209..486 17..294 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:10:45 Download gff for BS28535.complete
Subject Subject Range Query Range Percent Splice Strand
CG17977-RA 212..489 17..294 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:31 Download gff for BS28535.complete
Subject Subject Range Query Range Percent Splice Strand
CG17977-RA 212..489 17..294 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:31 Download gff for BS28535.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8067125..8067293 119..287 100 <- Minus
2R 8067343..8067444 17..118 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:10:45 Download gff for BS28535.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3954630..3954798 119..287 100 <- Minus
arm_2R 3954848..3954949 17..118 100   Minus

BS28535.pep Sequence

Translation from 16 to 294

> BS28535.pep
MTFARWNWTIFPCMIPTSFPIWMRIFQSRAIAQNAHIIHRILRPEGRIEP
LKNNLSKMFNYDILMAYNCDGELSVSSQSSHTNILTKLFLGS*

BS28535.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG17977-PA 92 CG17977-PA 1..92 1..92 493 100 Plus