BS28538.complete Sequence
311 bp assembled on 2012-03-26
GenBank Submission: KX801518
> BS28538.complete
GAAGTTATCAGTCGACATGAAGTCCGCACTACTTTTGATCTGCCTTGCCT
TCTTCGTGGCGCTCCTAAGCACCGGAAATGCGTGCGATCCCAATTCTGAC
AACCAGCCCGACTGCAGCGACGCATCCAACGTGCAAACGAACATCCGCAA
CTTCTGGGATCCCACTCGCTACTGGTGGTGTGAGTCCTCCACCTCCACGG
CCACGGCTGTGTTGTGCCCGTTGTCCACTGGATTCGACCCCACAAAGAAG
GAGTGCGTTTCATGGAGCGAATGGTCTTGGACTGCTTACTGTTGAAAGCT
TTCTAGACCAT
BS28538.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:08:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Peritrophin-15a-RA | 279 | CG17814-PA | 1..279 | 17..295 | 1395 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:08:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Peritrophin-15a-RA | 361 | CG17814-RA | 34..313 | 16..295 | 1400 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:08:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 8395713..8395982 | 295..26 | 1350 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 04:08:33 has no hits.
BS28538.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:16 Download gff for
BS28538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Peritrophin-15a-RA | 23..300 | 17..294 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:11:03 Download gff for
BS28538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Peritrophin-15a-RA | 35..312 | 17..294 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:43 Download gff for
BS28538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Peritrophin-15a-RA | 35..312 | 17..294 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:43 Download gff for
BS28538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 8395714..8395982 | 26..294 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:11:03 Download gff for
BS28538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 8395714..8395982 | 26..294 | 100 | | Minus |
BS28538.pep Sequence
Translation from 16 to 294
> BS28538.pep
MKSALLLICLAFFVALLSTGNACDPNSDNQPDCSDASNVQTNIRNFWDPT
RYWWCESSTSTATAVLCPLSTGFDPTKKECVSWSEWSWTAYC*
BS28538.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:01:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Peritrophin-15a-PA | 92 | CG17814-PA | 1..92 | 1..92 | 522 | 100 | Plus |
Peritrophin-15b-PC | 93 | CG31893-PC | 1..88 | 1..92 | 201 | 44.6 | Plus |
Peritrophin-15b-PA | 93 | CG31893-PA | 1..88 | 1..92 | 201 | 44.6 | Plus |
Peritrophin-15b-PB | 91 | CG31893-PB | 1..86 | 1..92 | 190 | 42.6 | Plus |
CG14645-PA | 97 | CG14645-PA | 12..85 | 16..88 | 161 | 39.2 | Plus |