Clone BS28538 Report

Search the DGRC for BS28538

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:285
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptPeritrophin-15a-RA
Protein status:BS28538.pep: gold
Sequenced Size:311

Clone Sequence Records

BS28538.complete Sequence

311 bp assembled on 2012-03-26

GenBank Submission: KX801518

> BS28538.complete
GAAGTTATCAGTCGACATGAAGTCCGCACTACTTTTGATCTGCCTTGCCT
TCTTCGTGGCGCTCCTAAGCACCGGAAATGCGTGCGATCCCAATTCTGAC
AACCAGCCCGACTGCAGCGACGCATCCAACGTGCAAACGAACATCCGCAA
CTTCTGGGATCCCACTCGCTACTGGTGGTGTGAGTCCTCCACCTCCACGG
CCACGGCTGTGTTGTGCCCGTTGTCCACTGGATTCGACCCCACAAAGAAG
GAGTGCGTTTCATGGAGCGAATGGTCTTGGACTGCTTACTGTTGAAAGCT
TTCTAGACCAT

BS28538.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Peritrophin-15a-RA 279 CG17814-PA 1..279 17..295 1395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Peritrophin-15a-RA 361 CG17814-RA 34..313 16..295 1400 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8395713..8395982 295..26 1350 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:08:33 has no hits.

BS28538.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:16 Download gff for BS28538.complete
Subject Subject Range Query Range Percent Splice Strand
Peritrophin-15a-RA 23..300 17..294 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:11:03 Download gff for BS28538.complete
Subject Subject Range Query Range Percent Splice Strand
Peritrophin-15a-RA 35..312 17..294 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:43 Download gff for BS28538.complete
Subject Subject Range Query Range Percent Splice Strand
Peritrophin-15a-RA 35..312 17..294 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:43 Download gff for BS28538.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8395714..8395982 26..294 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:11:03 Download gff for BS28538.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8395714..8395982 26..294 100   Minus

BS28538.pep Sequence

Translation from 16 to 294

> BS28538.pep
MKSALLLICLAFFVALLSTGNACDPNSDNQPDCSDASNVQTNIRNFWDPT
RYWWCESSTSTATAVLCPLSTGFDPTKKECVSWSEWSWTAYC*

BS28538.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:01:31
Subject Length Description Subject Range Query Range Score Percent Strand
Peritrophin-15a-PA 92 CG17814-PA 1..92 1..92 522 100 Plus
Peritrophin-15b-PC 93 CG31893-PC 1..88 1..92 201 44.6 Plus
Peritrophin-15b-PA 93 CG31893-PA 1..88 1..92 201 44.6 Plus
Peritrophin-15b-PB 91 CG31893-PB 1..86 1..92 190 42.6 Plus
CG14645-PA 97 CG14645-PA 12..85 16..88 161 39.2 Plus