Clone BS28539 Report

Search the DGRC for BS28539

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:285
Well:39
Vector:pDNR-Dual
Associated Gene/Transcriptnoe-RB
Protein status:BS28539.pep: gold
Sequenced Size:257

Clone Sequence Records

BS28539.complete Sequence

257 bp assembled on 2012-03-26

GenBank Submission: KX803036

> BS28539.complete
GAAGTTATCAGTCGACATGGTGCCAACCCCCCTGGCCCCCCCAAAAGGGG
GGTGGTGCTGGTGCAATTGCAAAGGCACAGGAGCACAGGAGCAGCTAAAT
AAACAAGAAAGCAAAATCAACAACCGCAAAAGTCTAAGACATGTATCACG
AATTGAAAATGATAATGACAAAATGAGAAAAAACAAATATCAGACCAAAG
TTATATCAATGCAAACAAAAAAATCTAAAAAATACACATAAAAGCTTTCT
AGACCAT

BS28539.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
noe-RC 225 CG32172-PC 1..225 17..241 1125 100 Plus
noe-RB 225 CG32172-PB 1..225 17..241 1125 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
noe-RC 1002 CG32172-RC 159..385 17..243 1135 100 Plus
noe-RB 903 CG32172-RB 159..385 17..243 1135 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17400964..17401190 243..17 1135 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:08:37 has no hits.

BS28539.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:16 Download gff for BS28539.complete
Subject Subject Range Query Range Percent Splice Strand
noe-RC 159..368 17..226 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:11:05 Download gff for BS28539.complete
Subject Subject Range Query Range Percent Splice Strand
noe-RB 159..368 17..226 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:44 Download gff for BS28539.complete
Subject Subject Range Query Range Percent Splice Strand
noe-RB 159..368 17..226 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:44 Download gff for BS28539.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17400981..17401190 17..226 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:11:05 Download gff for BS28539.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17394081..17394290 17..226 100   Minus

BS28539.pep Sequence

Translation from 16 to 240

> BS28539.pep
MVPTPLAPPKGGWCWCNCKGTGAQEQLNKQESKINNRKSLRHVSRIENDN
DKMRKNKYQTKVISMQTKKSKKYT*

BS28539.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
noe-PC 74 CG32172-PC 1..74 1..74 406 100 Plus
noe-PB 74 CG32172-PB 1..74 1..74 406 100 Plus