BS28539.complete Sequence
257 bp assembled on 2012-03-26
GenBank Submission: KX803036
> BS28539.complete
GAAGTTATCAGTCGACATGGTGCCAACCCCCCTGGCCCCCCCAAAAGGGG
GGTGGTGCTGGTGCAATTGCAAAGGCACAGGAGCACAGGAGCAGCTAAAT
AAACAAGAAAGCAAAATCAACAACCGCAAAAGTCTAAGACATGTATCACG
AATTGAAAATGATAATGACAAAATGAGAAAAAACAAATATCAGACCAAAG
TTATATCAATGCAAACAAAAAAATCTAAAAAATACACATAAAAGCTTTCT
AGACCAT
BS28539.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:08:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
noe-RC | 225 | CG32172-PC | 1..225 | 17..241 | 1125 | 100 | Plus |
noe-RB | 225 | CG32172-PB | 1..225 | 17..241 | 1125 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:08:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
noe-RC | 1002 | CG32172-RC | 159..385 | 17..243 | 1135 | 100 | Plus |
noe-RB | 903 | CG32172-RB | 159..385 | 17..243 | 1135 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:08:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 17400964..17401190 | 243..17 | 1135 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 04:08:37 has no hits.
BS28539.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:16 Download gff for
BS28539.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
noe-RC | 159..368 | 17..226 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:11:05 Download gff for
BS28539.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
noe-RB | 159..368 | 17..226 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:44 Download gff for
BS28539.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
noe-RB | 159..368 | 17..226 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:44 Download gff for
BS28539.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 17400981..17401190 | 17..226 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:11:05 Download gff for
BS28539.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 17394081..17394290 | 17..226 | 100 | | Minus |
BS28539.pep Sequence
Translation from 16 to 240
> BS28539.pep
MVPTPLAPPKGGWCWCNCKGTGAQEQLNKQESKINNRKSLRHVSRIENDN
DKMRKNKYQTKVISMQTKKSKKYT*
BS28539.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:01:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
noe-PC | 74 | CG32172-PC | 1..74 | 1..74 | 406 | 100 | Plus |
noe-PB | 74 | CG32172-PB | 1..74 | 1..74 | 406 | 100 | Plus |