Clone BS28542 Report

Search the DGRC for BS28542

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:285
Well:42
Vector:pDNR-Dual
Associated Gene/Transcriptkarr-RA
Protein status:BS28542.pep: full length peptide match
Sequenced Size:326

Clone Sequence Records

BS28542.complete Sequence

326 bp assembled on 2012-03-26

GenBank Submission: KX802230

> BS28542.complete
GAAGTTATCAGTCGACATGGCAGAGAAGTCGAACGCGGATGCGAAGGCAT
CTAAAAACAACAAGTACATGACGAGCGAGGATCCTGAGCAGCCAAGTGAA
TCGTCCACCCAGAAGGAGAAGGGTTCGCAGTCTTCAGAGTCCGAGGAAGA
ATACTTTAAGAATGTGTCCGAGCGCTTCGATAAGGACATAAAGGACCTGA
AAGATCTGATTGCCCTGAATGAGAAGGAATGTAATAGGCTGTTATTCGAT
CGCCTCCTGGATGTAATCAGAGTGGAAATAGAAGAAAAGCTACATTTGCC
GAAGAAATAGAAGCTTTCTAGACCAT

BS28542.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
karr-RA 294 CG15323-PA 1..294 17..310 1470 100 Plus
CG42583-RA 318 CG42583-PA 1..87 17..103 195 81.6 Plus
CG34332-RA 264 CG34332-PA 1..87 17..103 195 81.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
karr-RA 466 CG15323-RA 100..393 17..310 1470 100 Plus
CG42583-RA 378 CG42583-RA 61..147 17..103 195 81.6 Plus
CG34332-RA 412 CG34332-RA 97..183 17..103 195 81.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20110183..20110476 310..17 1470 100 Minus
X 23542271 X 20139853..20139939 17..103 195 81.6 Plus
X 23542271 X 20141106..20141192 17..103 195 81.6 Plus
X 23542271 X 20096394..20096472 103..25 185 82.3 Minus
Blast to na_te.dros performed on 2014-11-28 04:08:47 has no hits.

BS28542.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:18 Download gff for BS28542.complete
Subject Subject Range Query Range Percent Splice Strand
CG15323-RA 100..387 17..304 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:11:09 Download gff for BS28542.complete
Subject Subject Range Query Range Percent Splice Strand
CG15323-RA 100..387 17..304 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:49 Download gff for BS28542.complete
Subject Subject Range Query Range Percent Splice Strand
karr-RA 100..387 17..304 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:49 Download gff for BS28542.complete
Subject Subject Range Query Range Percent Splice Strand
X 20110189..20110476 17..304 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:11:09 Download gff for BS28542.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20004222..20004509 17..304 100   Minus

BS28542.pep Sequence

Translation from 16 to 309

> BS28542.pep
MAEKSNADAKASKNNKYMTSEDPEQPSESSTQKEKGSQSSESEEEYFKNV
SERFDKDIKDLKDLIALNEKECNRLLFDRLLDVIRVEIEEKLHLPKK*

BS28542.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
karr-PA 97 CG15323-PA 1..97 1..97 488 100 Plus
CG42578-PA 92 CG42578-PA 1..89 1..94 171 43.6 Plus
CG34332-PA 87 CG34332-PA 1..84 1..94 158 40.4 Plus
CG42577-PA 92 CG42577-PA 1..89 1..94 148 40.4 Plus
CG42581-PA 85 CG42581-PA 2..82 4..94 142 38.5 Plus