Clone BS28543 Report

Search the DGRC for BS28543

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:285
Well:43
Vector:pDNR-Dual
Associated Gene/TranscriptCG44242-RB
Protein status:BS28543.pep: full length peptide match
Sequenced Size:275

Clone Sequence Records

BS28543.complete Sequence

275 bp assembled on 2012-03-26

GenBank Submission: KX800492

> BS28543.complete
GAAGTTATCAGTCGACATGGTTCGACCAACACTAGTTGCGCTGGCTAAGC
GCGTACCGCTCATACACTTCCGCAAGGGTGGTGCAGGAGTGCCGGGCGCC
CAGACAGCAAACCAGAAGGCAAGTTCCCAGGCCGCAGGAGGCAAAAAGTT
GGCCGGTGGACCAGCAATTGAGGACTACGAGCTGCCGGCACGATTTGCCC
GCAAGCCAATTGATCCCGAAGAGGCGGCTTACATTAATAATGGGGGTATT
CCAAACTGAAAGCTTTCTAGACCAT

BS28543.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG44242-RB 243 CG44242-PB 1..243 17..259 1215 100 Plus
CG44242-RA 213 CG44242-PA 100..213 146..259 570 100 Plus
CG44242-RA 213 CG44242-PA 1..102 17..118 510 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG44242-RB 456 CG44242-RB 88..331 17..260 1220 100 Plus
CG44242-RA 426 CG44242-RA 187..301 146..260 575 100 Plus
CG44242-RA 426 CG44242-RA 88..189 17..118 510 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16196471..16196602 17..148 660 100 Plus
2R 25286936 2R 16196690..16196803 147..260 570 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:08:50 has no hits.

BS28543.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:18 Download gff for BS28543.complete
Subject Subject Range Query Range Percent Splice Strand
CG8446-RE 86..327 17..258 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:11:11 Download gff for BS28543.complete
Subject Subject Range Query Range Percent Splice Strand
CG44242-RB 88..329 17..258 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:51 Download gff for BS28543.complete
Subject Subject Range Query Range Percent Splice Strand
CG44242-RB 88..329 17..258 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:51 Download gff for BS28543.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16196471..16196602 17..148 100 -> Plus
2R 16196692..16196801 149..258 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:11:11 Download gff for BS28543.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12083976..12084107 17..148 100 -> Plus
arm_2R 12084197..12084306 149..258 100   Plus

BS28543.pep Sequence

Translation from 16 to 258

> BS28543.pep
MVRPTLVALAKRVPLIHFRKGGAGVPGAQTANQKASSQAAGGKKLAGGPA
IEDYELPARFARKPIDPEEAAYINNGGIPN*

BS28543.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG44242-PB 80 CG44242-PB 1..80 1..80 411 100 Plus
CG44242-PA 70 CG44242-PA 1..70 1..80 343 87.5 Plus