BS28543.complete Sequence
275 bp assembled on 2012-03-26
GenBank Submission: KX800492
> BS28543.complete
GAAGTTATCAGTCGACATGGTTCGACCAACACTAGTTGCGCTGGCTAAGC
GCGTACCGCTCATACACTTCCGCAAGGGTGGTGCAGGAGTGCCGGGCGCC
CAGACAGCAAACCAGAAGGCAAGTTCCCAGGCCGCAGGAGGCAAAAAGTT
GGCCGGTGGACCAGCAATTGAGGACTACGAGCTGCCGGCACGATTTGCCC
GCAAGCCAATTGATCCCGAAGAGGCGGCTTACATTAATAATGGGGGTATT
CCAAACTGAAAGCTTTCTAGACCAT
BS28543.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:08:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44242-RB | 243 | CG44242-PB | 1..243 | 17..259 | 1215 | 100 | Plus |
CG44242-RA | 213 | CG44242-PA | 100..213 | 146..259 | 570 | 100 | Plus |
CG44242-RA | 213 | CG44242-PA | 1..102 | 17..118 | 510 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:08:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44242-RB | 456 | CG44242-RB | 88..331 | 17..260 | 1220 | 100 | Plus |
CG44242-RA | 426 | CG44242-RA | 187..301 | 146..260 | 575 | 100 | Plus |
CG44242-RA | 426 | CG44242-RA | 88..189 | 17..118 | 510 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:08:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 16196471..16196602 | 17..148 | 660 | 100 | Plus |
2R | 25286936 | 2R | 16196690..16196803 | 147..260 | 570 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:08:50 has no hits.
BS28543.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:18 Download gff for
BS28543.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8446-RE | 86..327 | 17..258 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:11:11 Download gff for
BS28543.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG44242-RB | 88..329 | 17..258 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:51 Download gff for
BS28543.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG44242-RB | 88..329 | 17..258 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:51 Download gff for
BS28543.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16196471..16196602 | 17..148 | 100 | -> | Plus |
2R | 16196692..16196801 | 149..258 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:11:11 Download gff for
BS28543.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 12083976..12084107 | 17..148 | 100 | -> | Plus |
arm_2R | 12084197..12084306 | 149..258 | 100 | | Plus |
BS28543.pep Sequence
Translation from 16 to 258
> BS28543.pep
MVRPTLVALAKRVPLIHFRKGGAGVPGAQTANQKASSQAAGGKKLAGGPA
IEDYELPARFARKPIDPEEAAYINNGGIPN*
BS28543.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:02:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44242-PB | 80 | CG44242-PB | 1..80 | 1..80 | 411 | 100 | Plus |
CG44242-PA | 70 | CG44242-PA | 1..70 | 1..80 | 343 | 87.5 | Plus |