BS28559.complete Sequence
251 bp assembled on 2012-03-26
GenBank Submission: KX802264
> BS28559.complete
GAAGTTATCAGTCGACATGATGCAAATCAAGTTCCTGTTCACCTTCCTCG
CTCTGCTGATGATGGTCATCCTGGGCGCCAAGGAAGCCGATGCCGACTGC
CTTTCCGGAAGGTACAGAGGTCCCTGTGCCGTCTGGGACAACGAGACATG
CAGGCGGGTTTGCCGAGAGGAGGGACGAGGACGAGTGAGTGGTCACTGCA
GTGCCAGGCTGCAATGCTGGTGCGAAGGATGCTGAAAGCTTTCTAGACCA
T
BS28559.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:09:04
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl6-RA | 219 | CG32268-PA | 1..219 | 17..235 | 1095 | 100 | Plus |
| Drsl5-RA | 210 | CG10812-PA | 1..208 | 20..233 | 420 | 80.8 | Plus |
| Drs-RA | 213 | CG10810-PA | 1..211 | 17..233 | 405 | 80.2 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:09:04
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl6-RA | 387 | CG32268-RA | 57..276 | 17..236 | 1100 | 100 | Plus |
| Drsl5-RA | 364 | CG10812-RA | 48..262 | 13..233 | 425 | 80.5 | Plus |
| Drs-RA | 387 | CG10810-RA | 64..274 | 17..233 | 405 | 80.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:09:02
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 3336143..3336362 | 236..17 | 1100 | 100 | Minus |
| 3L | 28110227 | 3L | 3316828..3317042 | 13..233 | 425 | 80.5 | Plus |
| 3L | 28110227 | 3L | 3369619..3369829 | 17..233 | 405 | 80.2 | Plus |
| 3L | 28110227 | 3L | 3314365..3314588 | 7..236 | 305 | 76.5 | Plus |
Blast to na_te.dros performed 2014-11-28 04:09:03
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dvir\Ulysses | 10653 | Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). | 3437..3481 | 192..236 | 99 | 68.9 | Plus |
BS28559.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:21 Download gff for
BS28559.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| dro6-RA | 57..274 | 17..234 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:11:16 Download gff for
BS28559.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Drsl6-RA | 57..274 | 17..234 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:20:55 Download gff for
BS28559.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Drsl6-RA | 57..274 | 17..234 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:20:55 Download gff for
BS28559.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 3336145..3336362 | 17..234 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:11:16 Download gff for
BS28559.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 3336145..3336362 | 17..234 | 100 | | Minus |
BS28559.pep Sequence
Translation from 16 to 234
> BS28559.pep
MMQIKFLFTFLALLMMVILGAKEADADCLSGRYRGPCAVWDNETCRRVCR
EEGRGRVSGHCSARLQCWCEGC*
BS28559.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:02:22
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl6-PA | 72 | CG32268-PA | 1..72 | 1..72 | 403 | 100 | Plus |
| Drs-PA | 70 | CG10810-PA | 1..70 | 1..72 | 324 | 77.8 | Plus |
| Drsl5-PA | 69 | CG10812-PA | 1..69 | 2..72 | 316 | 78.9 | Plus |
| Drsl2-PA | 70 | CG32279-PA | 1..70 | 1..72 | 299 | 69.4 | Plus |
| Drsl1-PA | 69 | CG32274-PA | 1..69 | 2..72 | 247 | 60.6 | Plus |
