Clone BS28571 Report

Search the DGRC for BS28571

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:285
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptCG7443-RA
Protein status:BS28571.pep: gold
Sequenced Size:452

Clone Sequence Records

BS28571.complete Sequence

452 bp assembled on 2012-03-26

GenBank Submission: KX802099

> BS28571.complete
GAAGTTATCAGTCGACATGTTTAGTTTTCTGAGCATTGAGGCTAGGTCAT
TGGAGGAAACCTCTGTCAAGACGAAACGCGATACCGACTGGTGGACTATC
CTCGAGGATATACTCTATGACAATGATAGTGATAGTGATGATGCCGGCGA
TGAGAACGTTTTGATTTGTCGTAACTGCACGGTAGTTGTTCAAGCTGCTC
CAAACGCCACAGCGAATGGAAGCACTGTAGCTCCGCAGGCAGGTGGAGCA
GCTCCAGGGAGTTCACCAGGTGCGCCTGCCACTCCTCCTGGCTCGACTCC
TGCAGTTCCAGCCACAGTTGCACCCGAAACGCCTGCTCCGTCGGCACCTG
CGACATCGCCACAACCTGTAGTAACTGCCCTACCCACAGCTGCCCCACCT
ACAGCTGCCCCACCCACAGCTGCCCCTGGTGGTTAGAAGCTTTCTAGACC
AT

BS28571.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG7443-RA 420 CG7443-PA 1..420 17..436 2100 100 Plus
CG7443-RB 396 CG7443-PB 146..396 186..436 1255 100 Plus
CG7443-RB 396 CG7443-PB 1..146 17..162 730 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG7443-RA 616 CG7443-RA 62..482 17..437 2105 100 Plus
CG7443-RB 592 CG7443-RB 207..458 186..437 1260 100 Plus
CG7443-RB 592 CG7443-RB 62..207 17..162 730 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8324627..8324902 162..437 1380 100 Plus
3R 32079331 3R 8324485..8324573 73..161 445 100 Plus
3R 32079331 3R 8324377..8324433 17..73 285 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:09:31 has no hits.

BS28571.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:26 Download gff for BS28571.complete
Subject Subject Range Query Range Percent Splice Strand
CG7443-RA 49..462 23..436 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:11:32 Download gff for BS28571.complete
Subject Subject Range Query Range Percent Splice Strand
CG7443-RA 68..481 23..436 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:21:06 Download gff for BS28571.complete
Subject Subject Range Query Range Percent Splice Strand
CG7443-RA 68..481 23..436 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:21:06 Download gff for BS28571.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8324383..8324433 23..73 100 -> Plus
3R 8324486..8324573 74..161 100 -> Plus
3R 8324627..8324901 162..436 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:11:32 Download gff for BS28571.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4150105..4150155 23..73 100 -> Plus
arm_3R 4150208..4150295 74..161 100 -> Plus
arm_3R 4150349..4150623 162..436 100   Plus

BS28571.pep Sequence

Translation from 16 to 435

> BS28571.pep
MFSFLSIEARSLEETSVKTKRDTDWWTILEDILYDNDSDSDDAGDENVLI
CRNCTVVVQAAPNATANGSTVAPQAGGAAPGSSPGAPATPPGSTPAVPAT
VAPETPAPSAPATSPQPVVTALPTAAPPTAAPPTAAPGG*

BS28571.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG7443-PA 139 CG7443-PA 1..139 1..139 727 100 Plus
CG7443-PB 131 CG7443-PB 1..131 1..139 658 93.5 Plus