Clone BS28585 Report

Search the DGRC for BS28585

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:285
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptCG14563-RA
Protein status:BS28585.pep: gold
Sequenced Size:416

Clone Sequence Records

BS28585.complete Sequence

416 bp assembled on 2012-03-26

GenBank Submission: KX801421

> BS28585.complete
GAAGTTATCAGTCGACATGGCCAGAAAAATCATGTCAGTGAAACAGTCGA
GCCGCTCTCCATGTTGTTGGTTCGGTTTGCTCCTGGTCGCCATTTTCCTG
CAGCCATCCGCGAGCCAATACTACGGTTATCCCTATTACGGCGGCGCTAA
TGCGGGAGCGGGATCGGGATACGGGAACATATACGGCAGCGGCATGTACG
GATACCCCTACAGCTACGGCGGATATCCGTACTACTCGTATCCCGGCTAC
AACCCGTACTCGATGTACGGTGGATACGGGCAGTACGGATACCCCTATGG
AGGATATCCCTACGGCGGCAATGGCATGAACGTGGCCTACGCCAGCAGCA
GTGGAGGATTCGCAACAGCCAGTGCGGGTGGAAGCGGATACTACGGCTAG
AAGCTTTCTAGACCAT

BS28585.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14563-RA 369 CG14563-PA 1..369 32..400 1845 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:10:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14563-RA 499 CG14563-RA 15..400 15..400 1930 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:10:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21842058..21842372 329..15 1575 100 Minus
3L 28110227 3L 21841907..21841977 400..330 355 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:10:25 has no hits.

BS28585.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:36 Download gff for BS28585.complete
Subject Subject Range Query Range Percent Splice Strand
CG14563-RA 17..400 17..400 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:12:02 Download gff for BS28585.complete
Subject Subject Range Query Range Percent Splice Strand
CG14563-RA 17..400 17..400 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:21:33 Download gff for BS28585.complete
Subject Subject Range Query Range Percent Splice Strand
CG14563-RA 17..400 17..400 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:21:33 Download gff for BS28585.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21841907..21841977 330..400 100 <- Minus
3L 21842058..21842370 17..329 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:12:02 Download gff for BS28585.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21835007..21835077 330..400 100 <- Minus
arm_3L 21835158..21835470 17..329 100   Minus

BS28585.pep Sequence

Translation from 16 to 399

> BS28585.pep
MARKIMSVKQSSRSPCCWFGLLLVAIFLQPSASQYYGYPYYGGANAGAGS
GYGNIYGSGMYGYPYSYGGYPYYSYPGYNPYSMYGGYGQYGYPYGGYPYG
GNGMNVAYASSSGGFATASAGGSGYYG*

BS28585.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14563-PA 122 CG14563-PA 1..122 6..127 698 100 Plus
CG9269-PA 146 CG9269-PA 48..142 37..127 138 43.7 Plus