Clone BS28592 Report

Search the DGRC for BS28592

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:285
Well:92
Vector:pDNR-Dual
Associated Gene/TranscriptCG15919-RA
Protein status:BS28592.pep: gold
Sequenced Size:365

Clone Sequence Records

BS28592.complete Sequence

365 bp assembled on 2012-03-26

GenBank Submission: KX805462

> BS28592.complete
GAAGTTATCAGTCGACATGAAAGCGGCGAAAAGTGGCGACAGGATGGCGT
ATCCATGGATTAAAATGAGGCCCCTGCTGATGCTGACAGTAATATTGGTC
ATTTTCTTCAGCTACGGCCTGGCCGGCAAGACGACCACCATCGTTAGCCA
CACAGACACCCTCGATCCGCAGGCCGATGGCTTCTGGGTCAACAAGACGA
CGTGGAACGCTCGCTGGGTAAAGTACTGGCGGGCCAAGAAGATCTACGAG
CCGGTGTGGAAAAAGGTCTGGACACCCACCATTCACAACGAGTGGGTGCC
CTTGCCCAATGTGCCCAATGAATGGGAGGCGGAAAAGGATCGCTCCTAAA
AGCTTTCTAGACCAT

BS28592.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG15919-RA 333 CG15919-PA 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG15919-RA 447 CG15919-RA 14..350 15..351 1685 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16792869..16793082 138..351 1055 99.5 Plus
2R 25286936 2R 16792655..16792781 15..141 635 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:10:42 has no hits.

BS28592.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:39 Download gff for BS28592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15919-RA 1..331 17..347 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:12:13 Download gff for BS28592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15919-RA 16..346 17..347 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:21:41 Download gff for BS28592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15919-RA 16..346 17..347 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:21:41 Download gff for BS28592.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16792657..16792781 17..141 100 -> Plus
2R 16792873..16793078 142..347 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:12:13 Download gff for BS28592.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12680162..12680286 17..141 100 -> Plus
arm_2R 12680378..12680583 142..347 100   Plus

BS28592.pep Sequence

Translation from 16 to 348

> BS28592.pep
MKAAKSGDRMAYPWIKMRPLLMLTVILVIFFSYGLAGKTTTIVSHTDTLD
PQADGFWVNKTTWNARWVKYWRAKKIYEPVWKKVWTPTIHNEWVPLPNVP
NEWEAEKDRS*

BS28592.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG15919-PA 110 CG15919-PA 1..110 1..110 617 100 Plus