Clone BS28690 Report

Search the DGRC for BS28690

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:286
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptCG42718-RA
Protein status:BS28690.pep: gold
Sequenced Size:272

Clone Sequence Records

BS28690.complete Sequence

272 bp assembled on 2012-03-26

GenBank Submission: KX802396

> BS28690.complete
GAAGTTATCAGTCGACATGCACAGAATGCTGCTCTACACTTTGGTAATCG
TTGCCCTTGCTTTGGTTCAGGCCTGCCAAATCCATCATAATCTGACATTT
CCTGCTGTGGACCAAGTTTCCGACTGTTCTGGCCACTACCTCACTTTTGG
TAATCGGAGTTTGACAAGGGATCTGCCCACATTAACCCCAGGCAATTCGA
TGTCATCTCGGCTTGAACTTTGCTTTTATGGCAAACCTTTTACGCTGGGG
CATTAGAAGCTTTCTAGACCAT

BS28690.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:11:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG42718-RA 240 CG42718-PA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:11:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG42718-RA 351 CG42718-RA 52..293 15..256 1210 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16320888..16321116 256..28 1145 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:11:24 has no hits.

BS28690.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:13:46 Download gff for BS28690.complete
Subject Subject Range Query Range Percent Splice Strand
CG42718-RA 54..293 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:12:33 Download gff for BS28690.complete
Subject Subject Range Query Range Percent Splice Strand
CG42718-RA 54..293 17..256 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:21:59 Download gff for BS28690.complete
Subject Subject Range Query Range Percent Splice Strand
CG42718-RA 54..293 17..256 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:21:59 Download gff for BS28690.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16320888..16321116 28..256 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:12:33 Download gff for BS28690.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16313988..16314216 28..256 100   Minus

BS28690.pep Sequence

Translation from 16 to 255

> BS28690.pep
MHRMLLYTLVIVALALVQACQIHHNLTFPAVDQVSDCSGHYLTFGNRSLT
RDLPTLTPGNSMSSRLELCFYGKPFTLGH*

BS28690.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG42718-PA 79 CG42718-PA 1..79 1..79 421 100 Plus