Clone BS28701 Report

Search the DGRC for BS28701

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptCG14817-RA
Protein status:BS28701.pep: full length peptide match
Sequenced Size:353

Clone Sequence Records

BS28701.complete Sequence

353 bp assembled on 2012-03-26

GenBank Submission: KX806436

> BS28701.complete
GAAGTTATCAGTCGACATGCACCTGACGCTGATCAATTTGTTCAAGAAGA
CTGTGCCCGGCCACATATTCCGGGGCAAGCGGCGCCTGGTGAAACCGGTC
AGTCAGCGAGCAATGGACACCCTGACCCACGAGTACGAGCGCCAGGAGCA
GGTAATGTTACTCCTCCGACACCCGTATCTCACCATGGAGCAGTCATTCG
GTCATGCCAAGGAGCTGCAGAAGCGCGAGAAGCTCGTTGCCAGATGGACG
GACGAGCAGACACTGCGCAAGATGAAGCCACACGTTACCATCGAGGAGCG
GCTGAACCAGCTGAAGATCAAGGAGGCCTGGGACTAGAAGCTTTCTAGAC
CAT

BS28701.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG14817-RB 321 CG14817-PB 1..321 17..337 1605 100 Plus
CG14817-RA 321 CG14817-PA 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG14817-RB 920 CG14817-RB 132..452 17..337 1605 100 Plus
CG14817-RA 508 CG14817-RA 132..452 17..337 1605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1876968..1877139 188..17 860 100 Minus
X 23542271 X 1876762..1876912 337..187 755 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:15:54 has no hits.

BS28701.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:32 Download gff for BS28701.complete
Subject Subject Range Query Range Percent Splice Strand
CG14817-RA 60..380 17..337 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:14:49 Download gff for BS28701.complete
Subject Subject Range Query Range Percent Splice Strand
CG14817-RA 132..452 17..337 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:00 Download gff for BS28701.complete
Subject Subject Range Query Range Percent Splice Strand
CG14817-RA 132..452 17..337 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:00 Download gff for BS28701.complete
Subject Subject Range Query Range Percent Splice Strand
X 1876762..1876911 188..337 100 <- Minus
X 1876969..1877139 17..187 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:14:49 Download gff for BS28701.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1770795..1770944 188..337 100 <- Minus
arm_X 1771002..1771172 17..187 100   Minus

BS28701.pep Sequence

Translation from 16 to 336

> BS28701.pep
MHLTLINLFKKTVPGHIFRGKRRLVKPVSQRAMDTLTHEYERQEQVMLLL
RHPYLTMEQSFGHAKELQKREKLVARWTDEQTLRKMKPHVTIEERLNQLK
IKEAWD*

BS28701.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG14817-PB 106 CG14817-PB 1..106 1..106 553 100 Plus
CG14817-PA 106 CG14817-PA 1..106 1..106 553 100 Plus