Clone BS28718 Report

Search the DGRC for BS28718

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:18
Vector:pDNR-Dual
Associated Gene/TranscriptHSPC300-RA
Protein status:BS28718.pep: full length peptide match
Sequenced Size:263

Clone Sequence Records

BS28718.complete Sequence

263 bp assembled on 2012-03-26

GenBank Submission: KX802769

> BS28718.complete
GAAGTTATCAGTCGACATGAGTGGGGCTCACAGAGAGGCGATCCAAAAGC
AGATCCACCAGGACTGGGCGAACAGGGAGTATATCGAAGTGATAACTGCC
AGCATAAAGAGAATCACCGACTTTCTGAACTCTTTCGATATGTCCTGTCG
CTCCCGTCTGGCGGTGCTGAACGAAAAACTAACGATCCTGGAGCGGCGCA
TAGACTATCTGGAGGCGTGCGTCGCCCAGGGTGAAACATTAACGTAAAAG
CTTTCTAGACCAT

BS28718.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
HSPC300-RB 231 CG30173-PB 1..231 17..247 1155 100 Plus
HSPC300-RA 231 CG30173-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:16:23
Subject Length Description Subject Range Query Range Score Percent Strand
HSPC300-RB 584 CG30173-RB 56..291 17..252 1165 99.6 Plus
HSPC300-RA 349 CG30173-RA 56..291 17..252 1165 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24028614..24028734 137..17 605 100 Minus
2R 25286936 2R 24028010..24028125 252..137 565 99.1 Minus
Blast to na_te.dros performed on 2014-11-28 04:16:21 has no hits.

BS28718.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:37 Download gff for BS28718.complete
Subject Subject Range Query Range Percent Splice Strand
HSPC300-RA 69..297 17..245 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:02 Download gff for BS28718.complete
Subject Subject Range Query Range Percent Splice Strand
HSPC300-RA 56..284 17..245 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:14 Download gff for BS28718.complete
Subject Subject Range Query Range Percent Splice Strand
HSPC300-RA 56..284 17..245 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:14 Download gff for BS28718.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24028017..24028124 138..245 100 <- Minus
2R 24028614..24028734 17..137 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:02 Download gff for BS28718.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19915540..19915647 138..245 100 <- Minus
arm_2R 19916137..19916257 17..137 100   Minus

BS28718.pep Sequence

Translation from 16 to 246

> BS28718.pep
MSGAHREAIQKQIHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAV
LNEKLTILERRIDYLEACVAQGETLT*

BS28718.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:08:24
Subject Length Description Subject Range Query Range Score Percent Strand
HSPC300-PB 76 CG30173-PB 1..76 1..76 385 100 Plus
HSPC300-PA 76 CG30173-PA 1..76 1..76 385 100 Plus