BS28718.complete Sequence
263 bp assembled on 2012-03-26
GenBank Submission: KX802769
> BS28718.complete
GAAGTTATCAGTCGACATGAGTGGGGCTCACAGAGAGGCGATCCAAAAGC
AGATCCACCAGGACTGGGCGAACAGGGAGTATATCGAAGTGATAACTGCC
AGCATAAAGAGAATCACCGACTTTCTGAACTCTTTCGATATGTCCTGTCG
CTCCCGTCTGGCGGTGCTGAACGAAAAACTAACGATCCTGGAGCGGCGCA
TAGACTATCTGGAGGCGTGCGTCGCCCAGGGTGAAACATTAACGTAAAAG
CTTTCTAGACCAT
BS28718.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:16:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HSPC300-RB | 231 | CG30173-PB | 1..231 | 17..247 | 1155 | 100 | Plus |
HSPC300-RA | 231 | CG30173-PA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:16:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HSPC300-RB | 584 | CG30173-RB | 56..291 | 17..252 | 1165 | 99.6 | Plus |
HSPC300-RA | 349 | CG30173-RA | 56..291 | 17..252 | 1165 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:16:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 24028614..24028734 | 137..17 | 605 | 100 | Minus |
2R | 25286936 | 2R | 24028010..24028125 | 252..137 | 565 | 99.1 | Minus |
Blast to na_te.dros performed on 2014-11-28 04:16:21 has no hits.
BS28718.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:37 Download gff for
BS28718.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
HSPC300-RA | 69..297 | 17..245 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:02 Download gff for
BS28718.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
HSPC300-RA | 56..284 | 17..245 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:14 Download gff for
BS28718.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
HSPC300-RA | 56..284 | 17..245 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:14 Download gff for
BS28718.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24028017..24028124 | 138..245 | 100 | <- | Minus |
2R | 24028614..24028734 | 17..137 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:02 Download gff for
BS28718.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19915540..19915647 | 138..245 | 100 | <- | Minus |
arm_2R | 19916137..19916257 | 17..137 | 100 | | Minus |
BS28718.pep Sequence
Translation from 16 to 246
> BS28718.pep
MSGAHREAIQKQIHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAV
LNEKLTILERRIDYLEACVAQGETLT*
BS28718.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:08:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HSPC300-PB | 76 | CG30173-PB | 1..76 | 1..76 | 385 | 100 | Plus |
HSPC300-PA | 76 | CG30173-PA | 1..76 | 1..76 | 385 | 100 | Plus |