Clone BS28723 Report

Search the DGRC for BS28723

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:23
Vector:pDNR-Dual
Associated Gene/Transcriptpallidin-RD
Protein status:BS28723.pep: full length peptide match
Sequenced Size:272

Clone Sequence Records

BS28723.complete Sequence

272 bp assembled on 2012-03-26

GenBank Submission: KX804227

> BS28723.complete
GAAGTTATCAGTCGACATGTTGAAGAGCAGCAATATAAATAGTGTCCTCA
ACGAACTCCCTAATGACCCAGCAAGGGATTCCACCGCCCAATCTTCTCAC
AATGGAAAACCAAAACAAGATGCGGAAACCTGTTGCTCCTCCCAGGACAA
CGAAGTCATGGCCAGTCTAGCCGCTTTACAGTTGTCCGCTGGCGTCCTGC
AAATAGCGGAGCCTCCACTAAACCATGTGCGCACCCAGCTTAGGGAATTG
ATGTAAAAGCTTTCTAGACCAT

BS28723.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
Pallidin-RB 504 CG14133-PB 1..236 17..252 1180 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
Pallidin-RB 952 CG14133-RB 67..302 17..252 1180 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11691036..11691252 256..40 1085 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:16:02 has no hits.

BS28723.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:34 Download gff for BS28723.complete
Subject Subject Range Query Range Percent Splice Strand
pallidin-RD 72..304 22..254 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:14:52 Download gff for BS28723.complete
Subject Subject Range Query Range Percent Splice Strand
pallidin-RD 72..304 22..254 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:04 Download gff for BS28723.complete
Subject Subject Range Query Range Percent Splice Strand
Pallidin-RB 72..302 22..254 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:04 Download gff for BS28723.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11691038..11691249 43..254 100 <- Minus
3L 11691308..11691328 22..42 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:14:52 Download gff for BS28723.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11684138..11684349 43..254 100 <- Minus
arm_3L 11684408..11684428 22..42 100   Minus

BS28723.pep Sequence

Translation from 16 to 255

> BS28723.pep
MLKSSNINSVLNELPNDPARDSTAQSSHNGKPKQDAETCCSSQDNEVMAS
LAALQLSAGVLQIAEPPLNHVRTQLRELM*

BS28723.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:08:07
Subject Length Description Subject Range Query Range Score Percent Strand
Pallidin-PB 167 CG14133-PB 1..79 1..79 394 98.7 Plus