Clone BS28726 Report

Search the DGRC for BS28726

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptCG42512-RA
Protein status:BS28726.pep: gold
Sequenced Size:362

Clone Sequence Records

BS28726.complete Sequence

362 bp assembled on 2012-05-15

GenBank Submission: KX800389

> BS28726.complete
GAAGTTATCAGTCGACATGGAGAACAAAAATGATATAAAAGAAATGGACC
TGGGCCTATCTCGAGCAGATATGTTGGAACAGCTCGAAAAAAGGCGAATA
TTTCTGGGCGATGGCAAGGATATGCCGCTGGATCGTCTGGAGGATATCTA
CCGCAATTACATAGTTCCCAAGCCAAAAAGAGAGCGCAAGCCGCGCAATC
CAAGTCCCGATCCCAATTTCAATCCCATTGAAATAGAGCAGCTAGCGGAG
CGCATCAAGTCGGTTGTCATAGTGGGACAGAAACGAGCGCATGCAGAGAA
TAAGAGCGACGACCAGGCCAAGCAAATCAAGATGGACCTGGACTGAAAGC
TTTCTAGACCAT

BS28726.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG42512-RB 303 CG42512-PB 1..303 44..346 1515 100 Plus
CG42512-RA 303 CG42512-PA 1..303 44..346 1515 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:21:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG42512-RB 617 CG42512-RB 81..410 17..346 1650 100 Plus
CG42512-RA 1782 CG42512-RA 81..410 17..346 1650 100 Plus
CG32573-RA 1782 CG32573-RA 81..410 17..346 1650 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16651587..16651841 92..346 1275 100 Plus
X 23542271 X 16651456..16651530 17..91 375 100 Plus
Blast to na_te.dros performed on 2014-11-28 11:21:02 has no hits.

BS28726.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-05-15 14:08:16 Download gff for BS28726.complete
Subject Subject Range Query Range Percent Splice Strand
CG32573-RA 81..409 17..345 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:20:31 Download gff for BS28726.complete
Subject Subject Range Query Range Percent Splice Strand
CG32573-RA 81..409 17..345 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:41:04 Download gff for BS28726.complete
Subject Subject Range Query Range Percent Splice Strand
CG32573-RA 81..409 17..345 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:41:04 Download gff for BS28726.complete
Subject Subject Range Query Range Percent Splice Strand
X 16651456..16651530 17..91 100 -> Plus
X 16651587..16651840 92..345 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:20:31 Download gff for BS28726.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16545489..16545563 17..91 100 -> Plus
arm_X 16545620..16545873 92..345 100   Plus

BS28726.pep Sequence

Translation from 16 to 345

> BS28726.pep
MENKNDIKEMDLGLSRADMLEQLEKRRIFLGDGKDMPLDRLEDIYRNYIV
PKPKRERKPRNPSPDPNFNPIEIEQLAERIKSVVIVGQKRAHAENKSDDQ
AKQIKMDLD*

BS28726.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG42512-PB 100 CG42512-PB 1..100 10..109 515 100 Plus
CG42512-PA 100 CG42512-PA 1..100 10..109 515 100 Plus