Clone BS28727 Report

Search the DGRC for BS28727

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:27
Vector:pDNR-Dual
Associated Gene/TranscriptCG30154-RA
Protein status:BS28727.pep: gold
Sequenced Size:227

Clone Sequence Records

BS28727.complete Sequence

227 bp assembled on 2012-03-26

GenBank Submission: KX801117

> BS28727.complete
GAAGTTATCAGTCGACATGTACCTACGTCAACAACTCTGGGTTCTCTTGC
TCTGGCTCTGCTTCGTCGTTCTCAGCGTGCATGGCATGCCGTGGAAATGG
GGACCTGCCTCCAATTCTGGACCCCATGGCGGACCCGCCTGGAATGGCGG
AGAAGAGTCCACCGACAATATAGTCATCCATTCGAAAAACAGCGGCAAGT
GGCGTTACTAAAAGCTTTCTAGACCAT

BS28727.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:16:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG30154-RA 195 CG30154-PA 1..195 17..211 975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:16:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG30154-RA 507 CG30154-RA 33..229 16..212 985 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:16:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20533521..20533656 77..212 680 100 Plus
2R 25286936 2R 20533391..20533452 16..77 310 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:16:46 has no hits.

BS28727.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:41 Download gff for BS28727.complete
Subject Subject Range Query Range Percent Splice Strand
CG30154-RA 19..211 17..209 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:12 Download gff for BS28727.complete
Subject Subject Range Query Range Percent Splice Strand
CG30154-RA 35..227 17..209 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:24 Download gff for BS28727.complete
Subject Subject Range Query Range Percent Splice Strand
CG30154-RA 34..226 17..209 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:24 Download gff for BS28727.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20533392..20533452 17..77 100 -> Plus
2R 20533522..20533653 78..209 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:12 Download gff for BS28727.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16420897..16420957 17..77 100 -> Plus
arm_2R 16421027..16421158 78..209 100   Plus

BS28727.pep Sequence

Translation from 16 to 210

> BS28727.pep
MYLRQQLWVLLLWLCFVVLSVHGMPWKWGPASNSGPHGGPAWNGGEESTD
NIVIHSKNSGKWRY*

BS28727.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG30154-PA 64 CG30154-PA 1..64 1..64 373 100 Plus