Clone BS28731 Report

Search the DGRC for BS28731

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptCG42561-RA
Protein status:BS28731.pep: full length peptide match
Sequenced Size:419

Clone Sequence Records

BS28731.complete Sequence

419 bp assembled on 2012-03-26

GenBank Submission: KX805164

> BS28731.complete
GAAGTTATCAGTCGACATGTCTCGCGATTTTTTCGCGCTGTTGGCAATTT
TCATCTTCACTGCGGTCAACGCGGCACCGCAAATTTCACCAACTATCGTT
CCGCAAATCCGCACAAATGGCTTTCAACTTGAGCCCCTCAATCAAGAATA
CTTTCTCAGAATCGAACATCCGGGTGGCACTATTCGCCAGGAATCCGTGA
GCCAGAATGAAGCCGGACATCTGCAGGTTAAAGGTGTGATTAACCAGCCC
TTCGAGGATCAGGATGCCAATCTTATTGTCACCTATGAGGCTGGTCCGAA
TGGATATGTTGCCAAATACAGCTTCGGCAAGGGTCCTCCAACACCGCCTC
CTGACACACCATTATTCCTCAGTCCCGGTGCTCTGAAAACTGCAGCGGGA
TAGAAGCTTTCTAGACCAT

BS28731.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:16:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42561-RA 387 CG42561-PA 1..387 17..403 1935 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:16:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG42561-RA 566 CG42561-RA 29..416 16..403 1940 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:16:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17685153..17685398 158..403 1230 100 Plus
2R 25286936 2R 17684973..17685095 37..159 615 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:16:51 has no hits.

BS28731.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:41 Download gff for BS28731.complete
Subject Subject Range Query Range Percent Splice Strand
CG42561-RA 167..553 17..403 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:14 Download gff for BS28731.complete
Subject Subject Range Query Range Percent Splice Strand
CG42561-RA 30..416 17..403 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:26 Download gff for BS28731.complete
Subject Subject Range Query Range Percent Splice Strand
CG42561-RA 30..416 17..403 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:26 Download gff for BS28731.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17684884..17684904 17..37 100 -> Plus
2R 17684974..17685095 38..159 100 -> Plus
2R 17685155..17685398 160..403 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:14 Download gff for BS28731.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13572389..13572409 17..37 100 -> Plus
arm_2R 13572479..13572600 38..159 100 -> Plus
arm_2R 13572660..13572903 160..403 100   Plus

BS28731.pep Sequence

Translation from 16 to 402

> BS28731.pep
MSRDFFALLAIFIFTAVNAAPQISPTIVPQIRTNGFQLEPLNQEYFLRIE
HPGGTIRQESVSQNEAGHLQVKGVINQPFEDQDANLIVTYEAGPNGYVAK
YSFGKGPPTPPPDTPLFLSPGALKTAAG*

BS28731.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG42561-PA 128 CG42561-PA 1..128 1..128 669 100 Plus
CG42562-PA 126 CG42562-PA 8..126 7..128 182 43.9 Plus