Clone BS28737 Report

Search the DGRC for BS28737

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptCpr49Af-RA
Protein status:BS28737.pep: gold
Sequenced Size:413

Clone Sequence Records

BS28737.complete Sequence

413 bp assembled on 2012-03-26

GenBank Submission: KX800819

> BS28737.complete
GAAGTTATCAGTCGACATGAAGTACCTAATGTTAATTGCCCTTTTTGTGG
TCGCTGCTTCGGCGACGGACAACGATGATCCGATTTCCCAGGAATCCAAT
GTGGAGTACAATGGCAAATACCATTATCATTATGAGCTCAAAGATGGCTC
GAAGGCCACTCAGGATGGAGTCTTGAAGTCCGTGAATGCCGATCACAACG
GGGAGTCGGTCAATGGAAAGTACTCCTTCGTCGCCGACGATGGAAAGACC
TATGTTGTGTCCTACACGGCGGACGAGAACGGATACCTTGCGGTGGGTGA
CCACCTGCCCACACCGCCACCCACGCCGGTGTCCGTTCTGAAGGCTCTGG
AGTACATCCGCCTGCATCCGTACAAGACGCCCGAGCAGAAGCAATAAAAG
CTTTCTAGACCAT

BS28737.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Af-RB 381 CG8510-PB 1..381 17..397 1905 100 Plus
Cpr49Af-RA 381 CG8510-PA 1..381 17..397 1905 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Af-RB 1056 CG8510-RB 73..454 16..397 1910 100 Plus
Cpr49Af-RA 533 CG8510-RA 73..454 16..397 1910 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12406176..12406443 130..397 1340 100 Plus
2R 25286936 2R 12406004..12406117 16..129 570 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:17:17 has no hits.

BS28737.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:45 Download gff for BS28737.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Af-RA 1..379 17..395 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:23 Download gff for BS28737.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Af-RA 74..452 17..395 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:37 Download gff for BS28737.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr49Af-RA 74..452 17..395 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:37 Download gff for BS28737.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12406005..12406117 17..129 100 -> Plus
2R 12406176..12406441 130..395 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:23 Download gff for BS28737.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8293510..8293622 17..129 100 -> Plus
arm_2R 8293681..8293946 130..395 100   Plus

BS28737.pep Sequence

Translation from 16 to 396

> BS28737.pep
MKYLMLIALFVVAASATDNDDPISQESNVEYNGKYHYHYELKDGSKATQD
GVLKSVNADHNGESVNGKYSFVADDGKTYVVSYTADENGYLAVGDHLPTP
PPTPVSVLKALEYIRLHPYKTPEQKQ*

BS28737.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr49Af-PB 126 CG8510-PB 1..126 1..126 666 100 Plus
Cpr49Af-PA 126 CG8510-PA 1..126 1..126 666 100 Plus
Cpr49Aa-PB 144 CG30045-PB 34..135 23..124 224 41.2 Plus
Edg78E-PB 122 CG7673-PB 3..120 2..126 219 39.8 Plus
Edg78E-PA 122 CG7673-PA 3..120 2..126 219 39.8 Plus