BS28738.complete Sequence
218 bp assembled on 2012-03-26
GenBank Submission: KX803743
> BS28738.complete
GAAGTTATCAGTCGACATGAAGTTTTTTGCCATCCTCCTCCTTTTGTGCA
CCATGGTAGCTGTTGCAATTGCCGCAACAACCACAACCACAACGGAGAAC
ATTGATTGGGGTTCTGCAAGTACAACTGAAATACCGGCAACAACTACAGC
AACTCCATGTGAATCAGCTGACGCCAAGAAATTATATTTCTTTTATAAAT
AAAAGCTTTCTAGACCAT
BS28738.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:17:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42779-RA | 186 | CG42779-PA | 1..186 | 17..202 | 900 | 98.9 | Plus |
CG42779-RB | 186 | CG42779-PB | 1..186 | 17..202 | 900 | 98.9 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:17:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42779-RA | 256 | CG42779-RA | 15..202 | 15..202 | 910 | 98.9 | Plus |
CG42779-RB | 511 | CG42779-RB | 15..202 | 15..202 | 910 | 98.9 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:17:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 17121591..17121778 | 15..202 | 910 | 98.9 | Plus |
Blast to na_te.dros performed 2014-11-28 04:17:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
1360 | 3409 | 1360 1360 3409bp | 1193..1233 | 218..177 | 99 | 73.8 | Minus |
BS28738.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:46 Download gff for
BS28738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42779-RA | 1..178 | 17..194 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:25 Download gff for
BS28738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42779-RA | 17..194 | 17..194 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:38 Download gff for
BS28738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42779-RB | 17..194 | 17..194 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:38 Download gff for
BS28738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17121593..17121770 | 17..194 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:25 Download gff for
BS28738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 12947315..12947492 | 17..194 | 98 | | Plus |
BS28738.pep Sequence
Translation from 16 to 201
> BS28738.pep
MKFFAILLLLCTMVAVAIAATTTTTTENIDWGSASTTEIPATTTATPCES
ADAKKLYFFYK*
BS28738.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42779-PA | 61 | CG42779-PA | 1..61 | 1..61 | 311 | 100 | Plus |
CG42779-PB | 61 | CG42779-PB | 1..61 | 1..61 | 311 | 100 | Plus |