Clone BS28738 Report

Search the DGRC for BS28738

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptCG42779-RA
Protein status:BS28738.pep: gold
Sequenced Size:218

Clone Sequence Records

BS28738.complete Sequence

218 bp assembled on 2012-03-26

GenBank Submission: KX803743

> BS28738.complete
GAAGTTATCAGTCGACATGAAGTTTTTTGCCATCCTCCTCCTTTTGTGCA
CCATGGTAGCTGTTGCAATTGCCGCAACAACCACAACCACAACGGAGAAC
ATTGATTGGGGTTCTGCAAGTACAACTGAAATACCGGCAACAACTACAGC
AACTCCATGTGAATCAGCTGACGCCAAGAAATTATATTTCTTTTATAAAT
AAAAGCTTTCTAGACCAT

BS28738.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG42779-RA 186 CG42779-PA 1..186 17..202 900 98.9 Plus
CG42779-RB 186 CG42779-PB 1..186 17..202 900 98.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG42779-RA 256 CG42779-RA 15..202 15..202 910 98.9 Plus
CG42779-RB 511 CG42779-RB 15..202 15..202 910 98.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17121591..17121778 15..202 910 98.9 Plus
Blast to na_te.dros performed 2014-11-28 04:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
1360 3409 1360 1360 3409bp 1193..1233 218..177 99 73.8 Minus

BS28738.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:46 Download gff for BS28738.complete
Subject Subject Range Query Range Percent Splice Strand
CG42779-RA 1..178 17..194 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:25 Download gff for BS28738.complete
Subject Subject Range Query Range Percent Splice Strand
CG42779-RA 17..194 17..194 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:38 Download gff for BS28738.complete
Subject Subject Range Query Range Percent Splice Strand
CG42779-RB 17..194 17..194 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:38 Download gff for BS28738.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17121593..17121770 17..194 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:25 Download gff for BS28738.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12947315..12947492 17..194 98   Plus

BS28738.pep Sequence

Translation from 16 to 201

> BS28738.pep
MKFFAILLLLCTMVAVAIAATTTTTTENIDWGSASTTEIPATTTATPCES
ADAKKLYFFYK*

BS28738.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG42779-PA 61 CG42779-PA 1..61 1..61 311 100 Plus
CG42779-PB 61 CG42779-PB 1..61 1..61 311 100 Plus