BS28741.complete Sequence
326 bp assembled on 2012-03-26
GenBank Submission: KX801495
> BS28741.complete
GAAGTTATCAGTCGACATGTGGAAAATATTCTTGCTGTTGGTTCTTTGTA
TCCTGCAATTGTGCCACATTGATGCTCAATGGAGTCGAGTGTACTGTGAG
AATATCTATAACGATTGTCAACGATTTACATCCAGAATAGGACGATTTGA
TGAGACTATAGATTCCTTTAATCGTCATTGTCGTCGGGAGCGCAGAGGAA
GGTGGAACAGTGTGTCTCGATGTGAAATGGAAAAAGCCACCTGTCTTCTG
ATTTTTCGACGCTGTGATGATATGTCCTGTAACAACATTGCAGATGTCTT
GGAATTGTAAAAGCTTTCTAGACCAT
BS28741.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:17:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Eig71Ek-RA | 294 | CG7325-PA | 1..294 | 17..310 | 1470 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:17:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Eig71Ek-RA | 445 | CG7325-RA | 25..318 | 17..310 | 1470 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:17:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15661357..15661564 | 41..248 | 1040 | 100 | Plus |
3L | 28110227 | 3L | 15661621..15661682 | 249..310 | 310 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:17:29 has no hits.
BS28741.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:47 Download gff for
BS28741.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ek-RA | 25..316 | 17..308 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:29 Download gff for
BS28741.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ek-RA | 25..316 | 17..308 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:42 Download gff for
BS28741.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Ek-RA | 25..316 | 17..308 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:42 Download gff for
BS28741.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15661272..15661296 | 17..41 | 100 | -> | Plus |
3L | 15661358..15661564 | 42..248 | 100 | -> | Plus |
3L | 15661621..15661680 | 249..308 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:29 Download gff for
BS28741.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15654372..15654396 | 17..41 | 100 | -> | Plus |
arm_3L | 15654458..15654664 | 42..248 | 100 | -> | Plus |
arm_3L | 15654721..15654780 | 249..308 | 100 | | Plus |
BS28741.pep Sequence
Translation from 16 to 309
> BS28741.pep
MWKIFLLLVLCILQLCHIDAQWSRVYCENIYNDCQRFTSRIGRFDETIDS
FNRHCRRERRGRWNSVSRCEMEKATCLLIFRRCDDMSCNNIADVLEL*
BS28741.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Eig71Ek-PA | 97 | CG7325-PA | 1..97 | 1..97 | 538 | 100 | Plus |
Eig71Eg-PA | 98 | CG7336-PA | 1..96 | 1..95 | 190 | 35.1 | Plus |
Eig71Eb-PB | 95 | CG7355-PB | 1..93 | 1..95 | 160 | 36.5 | Plus |
Eig71Eb-PA | 95 | CG7355-PA | 1..93 | 1..95 | 160 | 36.5 | Plus |
Eig71Ei-PB | 102 | CG7327-PB | 1..101 | 1..97 | 151 | 33.3 | Plus |