Clone BS28741 Report

Search the DGRC for BS28741

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptEig71Ek-RA
Protein status:BS28741.pep: gold
Sequenced Size:326

Clone Sequence Records

BS28741.complete Sequence

326 bp assembled on 2012-03-26

GenBank Submission: KX801495

> BS28741.complete
GAAGTTATCAGTCGACATGTGGAAAATATTCTTGCTGTTGGTTCTTTGTA
TCCTGCAATTGTGCCACATTGATGCTCAATGGAGTCGAGTGTACTGTGAG
AATATCTATAACGATTGTCAACGATTTACATCCAGAATAGGACGATTTGA
TGAGACTATAGATTCCTTTAATCGTCATTGTCGTCGGGAGCGCAGAGGAA
GGTGGAACAGTGTGTCTCGATGTGAAATGGAAAAAGCCACCTGTCTTCTG
ATTTTTCGACGCTGTGATGATATGTCCTGTAACAACATTGCAGATGTCTT
GGAATTGTAAAAGCTTTCTAGACCAT

BS28741.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:17:30
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ek-RA 294 CG7325-PA 1..294 17..310 1470 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ek-RA 445 CG7325-RA 25..318 17..310 1470 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:17:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15661357..15661564 41..248 1040 100 Plus
3L 28110227 3L 15661621..15661682 249..310 310 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:17:29 has no hits.

BS28741.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:47 Download gff for BS28741.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ek-RA 25..316 17..308 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:29 Download gff for BS28741.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ek-RA 25..316 17..308 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:42 Download gff for BS28741.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Ek-RA 25..316 17..308 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:42 Download gff for BS28741.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15661272..15661296 17..41 100 -> Plus
3L 15661358..15661564 42..248 100 -> Plus
3L 15661621..15661680 249..308 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:29 Download gff for BS28741.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15654372..15654396 17..41 100 -> Plus
arm_3L 15654458..15654664 42..248 100 -> Plus
arm_3L 15654721..15654780 249..308 100   Plus

BS28741.pep Sequence

Translation from 16 to 309

> BS28741.pep
MWKIFLLLVLCILQLCHIDAQWSRVYCENIYNDCQRFTSRIGRFDETIDS
FNRHCRRERRGRWNSVSRCEMEKATCLLIFRRCDDMSCNNIADVLEL*

BS28741.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:22
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Ek-PA 97 CG7325-PA 1..97 1..97 538 100 Plus
Eig71Eg-PA 98 CG7336-PA 1..96 1..95 190 35.1 Plus
Eig71Eb-PB 95 CG7355-PB 1..93 1..95 160 36.5 Plus
Eig71Eb-PA 95 CG7355-PA 1..93 1..95 160 36.5 Plus
Eig71Ei-PB 102 CG7327-PB 1..101 1..97 151 33.3 Plus