Clone BS28747 Report

Search the DGRC for BS28747

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptCG42851-RB
Protein status:BS28747.pep: gold
Sequenced Size:260

Clone Sequence Records

BS28747.complete Sequence

260 bp assembled on 2012-03-26

GenBank Submission: KX805010

> BS28747.complete
GAAGTTATCAGTCGACATGTGGCTTCTCTTGCTCCTGCTGGGTCTGCCGA
TGGAAACAAACGAAGGAGAGGAGTGCAGAAATGGACTAACTCTCGGACGC
CAGCAGTGCTACCTCCACGAGGAGATCTTTCTAGCCCACCACCCTTTGCA
AAGTGTCACAGCCAAGAGGCTCAAGCTTCCCTGGTGGTGCGCCCTCCTAG
AAAGCCTCTTCCTGCTCCTGCTGGTGAAGCTGCTCCAGTTGTAGAAGCTT
TCTAGACCAT

BS28747.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:17:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG42851-RB 195 CG42851-PB 1..195 50..244 975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG42851-RB 783 CG42851-RB 104..333 16..245 1150 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24809428..24809657 16..245 1150 100 Plus
Blast to na_te.dros performed 2014-11-28 04:17:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 6398..6449 241..194 107 71.2 Minus
TART-C 11124 TART-C TARTC 11124bp 7854..7905 241..194 107 71.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2775..2800 244..219 103 88.5 Minus

BS28747.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:44 Download gff for BS28747.complete
Subject Subject Range Query Range Percent Splice Strand
CG42851-RA 82..309 17..244 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:20 Download gff for BS28747.complete
Subject Subject Range Query Range Percent Splice Strand
CG42851-RA 105..332 17..244 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:34 Download gff for BS28747.complete
Subject Subject Range Query Range Percent Splice Strand
CG42851-RB 105..332 17..244 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:34 Download gff for BS28747.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24809429..24809656 17..244 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:20 Download gff for BS28747.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20696952..20697179 17..244 100   Plus

BS28747.pep Sequence

Translation from 16 to 243

> BS28747.pep
MWLLLLLLGLPMETNEGEECRNGLTLGRQQCYLHEEIFLAHHPLQSVTAK
RLKLPWWCALLESLFLLLLVKLLQL*

BS28747.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG42851-PB 64 CG42851-PB 1..64 12..75 341 100 Plus