BS28747.complete Sequence
260 bp assembled on 2012-03-26
GenBank Submission: KX805010
> BS28747.complete
GAAGTTATCAGTCGACATGTGGCTTCTCTTGCTCCTGCTGGGTCTGCCGA
TGGAAACAAACGAAGGAGAGGAGTGCAGAAATGGACTAACTCTCGGACGC
CAGCAGTGCTACCTCCACGAGGAGATCTTTCTAGCCCACCACCCTTTGCA
AAGTGTCACAGCCAAGAGGCTCAAGCTTCCCTGGTGGTGCGCCCTCCTAG
AAAGCCTCTTCCTGCTCCTGCTGGTGAAGCTGCTCCAGTTGTAGAAGCTT
TCTAGACCAT
BS28747.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:17:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42851-RB | 195 | CG42851-PB | 1..195 | 50..244 | 975 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:17:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42851-RB | 783 | CG42851-RB | 104..333 | 16..245 | 1150 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:17:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 24809428..24809657 | 16..245 | 1150 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 04:17:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\TART | 8444 | Dyak\TART TARTYAK 8444bp | 6398..6449 | 241..194 | 107 | 71.2 | Minus |
TART-C | 11124 | TART-C TARTC 11124bp | 7854..7905 | 241..194 | 107 | 71.2 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2775..2800 | 244..219 | 103 | 88.5 | Minus |
BS28747.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:44 Download gff for
BS28747.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42851-RA | 82..309 | 17..244 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:20 Download gff for
BS28747.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42851-RA | 105..332 | 17..244 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:34 Download gff for
BS28747.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42851-RB | 105..332 | 17..244 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:34 Download gff for
BS28747.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24809429..24809656 | 17..244 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:20 Download gff for
BS28747.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 20696952..20697179 | 17..244 | 100 | | Plus |
BS28747.pep Sequence
Translation from 16 to 243
> BS28747.pep
MWLLLLLLGLPMETNEGEECRNGLTLGRQQCYLHEEIFLAHHPLQSVTAK
RLKLPWWCALLESLFLLLLVKLLQL*
BS28747.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:08:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42851-PB | 64 | CG42851-PB | 1..64 | 12..75 | 341 | 100 | Plus |