Clone BS28749 Report

Search the DGRC for BS28749

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG43103-RA
Protein status:BS28749.pep: full length peptide match
Sequenced Size:266

Clone Sequence Records

BS28749.complete Sequence

266 bp assembled on 2012-03-26

GenBank Submission: KX800520

> BS28749.complete
GAAGTTATCAGTCGACATGCTATCAAGATCCGTGCTGATCGTAGTAGGCC
TACTAATGCTGAGCTGGCAGTGGACGATGGCCATGCCGCCCCTTCCGAAG
AACCAACCCAGCGGAGTATCTATTAGTCAGCCCGATATACCGGGAGCCTC
GGATATTTTGGTGCAGAGCATCTTCAACATCGATCCATCGCTGTGTCCCA
AGGGGTACATACGCACGGGTCCACATCACACGTGTCGTAGGATAGCCTAG
AAGCTTTCTAGACCAT

BS28749.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG43103-RA 234 CG43103-PA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG43103-RA 482 CG43103-RA 60..293 17..250 1170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:17:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17139639..17139872 250..17 1170 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:17:49 has no hits.

BS28749.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:50 Download gff for BS28749.complete
Subject Subject Range Query Range Percent Splice Strand
CG43103-RA 54..287 17..250 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:39 Download gff for BS28749.complete
Subject Subject Range Query Range Percent Splice Strand
CG43103-RA 54..287 17..250 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:51 Download gff for BS28749.complete
Subject Subject Range Query Range Percent Splice Strand
CG43103-RA 60..293 17..250 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:51 Download gff for BS28749.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17139639..17139872 17..250 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:39 Download gff for BS28749.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13027144..13027377 17..250 100   Minus

BS28749.pep Sequence

Translation from 16 to 249

> BS28749.pep
MLSRSVLIVVGLLMLSWQWTMAMPPLPKNQPSGVSISQPDIPGASDILVQ
SIFNIDPSLCPKGYIRTGPHHTCRRIA*

BS28749.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG43103-PA 77 CG43103-PA 1..77 1..77 409 100 Plus