Clone BS28750 Report

Search the DGRC for BS28750

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptCG42806-RB
Protein status:BS28750.pep: full length peptide match
Sequenced Size:299

Clone Sequence Records

BS28750.complete Sequence

299 bp assembled on 2012-03-26

GenBank Submission: KX805050

> BS28750.complete
GAAGTTATCAGTCGACATGACCGATACCAGTGCAAATAATTTGGATGTAT
CGGTGGATGTGGTCTGGCCGACGATAATTGTCCTGGCCATGCTGGTCATA
AATGGCTTCGTTTTCGCCTACATTATGCGCAAGCGGCGGGAATACAAATG
CCAGGAGGAGGAGCTGCAGCAACAACAACAACCTGTTCCACATTCCTCCT
ATGCGGCCACTTCGACAACGGAACGGCATGCGGATGCGGATCAGGAGGAC
GATAGCTGTGCCATCGAGATGGAGCGACTGTAGAAGCTTTCTAGACCAT

BS28750.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG42806-RB 267 CG42806-PB 1..267 17..283 1335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG42806-RB 803 CG42806-RB 267..533 17..283 1335 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13964919..13965185 17..283 1335 100 Plus
Blast to na_te.dros performed 2014-11-28 04:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 973..1014 144..185 102 71.4 Plus
roo 9092 roo DM_ROO 9092bp 1127..1159 152..184 102 78.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2400..2430 152..182 101 80.6 Plus

BS28750.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:51 Download gff for BS28750.complete
Subject Subject Range Query Range Percent Splice Strand
CG42806-RB 252..518 17..283 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:41 Download gff for BS28750.complete
Subject Subject Range Query Range Percent Splice Strand
CG42806-RB 267..533 17..283 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:53 Download gff for BS28750.complete
Subject Subject Range Query Range Percent Splice Strand
CG42806-RB 267..533 17..283 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:53 Download gff for BS28750.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13964919..13965185 17..283 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:41 Download gff for BS28750.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9852424..9852690 17..283 100   Plus

BS28750.pep Sequence

Translation from 16 to 282

> BS28750.pep
MTDTSANNLDVSVDVVWPTIIVLAMLVINGFVFAYIMRKRREYKCQEEEL
QQQQQPVPHSSYAATSTTERHADADQEDDSCAIEMERL*

BS28750.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG42806-PB 88 CG42806-PB 1..88 1..88 453 100 Plus