BS28750.complete Sequence
299 bp assembled on 2012-03-26
GenBank Submission: KX805050
> BS28750.complete
GAAGTTATCAGTCGACATGACCGATACCAGTGCAAATAATTTGGATGTAT
CGGTGGATGTGGTCTGGCCGACGATAATTGTCCTGGCCATGCTGGTCATA
AATGGCTTCGTTTTCGCCTACATTATGCGCAAGCGGCGGGAATACAAATG
CCAGGAGGAGGAGCTGCAGCAACAACAACAACCTGTTCCACATTCCTCCT
ATGCGGCCACTTCGACAACGGAACGGCATGCGGATGCGGATCAGGAGGAC
GATAGCTGTGCCATCGAGATGGAGCGACTGTAGAAGCTTTCTAGACCAT
BS28750.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:17:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42806-RB | 267 | CG42806-PB | 1..267 | 17..283 | 1335 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:17:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42806-RB | 803 | CG42806-RB | 267..533 | 17..283 | 1335 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:17:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 13964919..13965185 | 17..283 | 1335 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 04:17:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
gypsy11 | 4428 | gypsy11 GYPSY11 4428bp | 973..1014 | 144..185 | 102 | 71.4 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1127..1159 | 152..184 | 102 | 78.8 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2400..2430 | 152..182 | 101 | 80.6 | Plus |
BS28750.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:51 Download gff for
BS28750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42806-RB | 252..518 | 17..283 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:41 Download gff for
BS28750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42806-RB | 267..533 | 17..283 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:53 Download gff for
BS28750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42806-RB | 267..533 | 17..283 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:53 Download gff for
BS28750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 13964919..13965185 | 17..283 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:41 Download gff for
BS28750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 9852424..9852690 | 17..283 | 100 | | Plus |
BS28750.pep Sequence
Translation from 16 to 282
> BS28750.pep
MTDTSANNLDVSVDVVWPTIIVLAMLVINGFVFAYIMRKRREYKCQEEEL
QQQQQPVPHSSYAATSTTERHADADQEDDSCAIEMERL*
BS28750.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42806-PB | 88 | CG42806-PB | 1..88 | 1..88 | 453 | 100 | Plus |