Clone BS28752 Report

Search the DGRC for BS28752

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCG42834-RA
Protein status:BS28752.pep: gold
Sequenced Size:401

Clone Sequence Records

BS28752.complete Sequence

401 bp assembled on 2012-03-26

GenBank Submission: KX804198

> BS28752.complete
GAAGTTATCAGACGACATGGCTCTTCGTATTATTTTTGTCTTCATTGCCA
CAATCGTCCTGGCGCAAGGATCAAATATTTCGCCAGTTGCGCAGGAGAAT
CTTGTGCGGGTCCATCACTCTGGAGTGGTTTCATCTGGAGCTCCTGCCGT
TGGTGTTACCCAGAGCCGCTCAGTTGTTTCGCAAGCTCAGCGTCCTAACT
ATGGTCAGAGATCCATCTCTGGATCTATCGGAGGATCTCGTCGAGTGGGC
GAAGTTCCAGTGTCCGGATCTCGTCCTCATGGTGGTGCTCCTCGTCGTTC
TTCTGCAAGCGCTTATGCTCGTCCCATCGGAGGTGGAGCTACCCCAGGAT
ATGTCCACCGCAACCGCAACCAGAAACCATATTAGAAGCTTTCTAGACCA
T

BS28752.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:18:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG42834-RA 369 CG42834-PA 1..369 17..385 1845 100 Plus
CG14332-RA 375 CG14332-PA 194..328 210..344 225 77.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:18:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG42834-RA 536 CG42834-RA 27..397 17..387 1855 100 Plus
CG14332-RA 513 CG14332-RA 220..354 210..344 225 77.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17418785..17419155 17..387 1855 100 Plus
3R 32079331 3R 17421849..17421983 344..210 225 77.8 Minus
Blast to na_te.dros performed on 2014-11-28 04:18:01 has no hits.

BS28752.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:52 Download gff for BS28752.complete
Subject Subject Range Query Range Percent Splice Strand
CG42834-RA 1..369 17..385 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:46 Download gff for BS28752.complete
Subject Subject Range Query Range Percent Splice Strand
CG42834-RA 27..395 17..385 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:56 Download gff for BS28752.complete
Subject Subject Range Query Range Percent Splice Strand
CG42834-RA 27..395 17..385 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:56 Download gff for BS28752.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17418785..17419153 17..385 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:46 Download gff for BS28752.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13244507..13244875 17..385 100   Plus

BS28752.pep Sequence

Translation from 16 to 384

> BS28752.pep
MALRIIFVFIATIVLAQGSNISPVAQENLVRVHHSGVVSSGAPAVGVTQS
RSVVSQAQRPNYGQRSISGSIGGSRRVGEVPVSGSRPHGGAPRRSSASAY
ARPIGGGATPGYVHRNRNQKPY*

BS28752.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG42834-PA 122 CG42834-PA 1..122 1..122 616 100 Plus
CG14332-PA 124 CG14332-PA 1..124 1..122 304 54.8 Plus
CG33333-PA 148 CG33333-PA 1..88 1..103 139 39.8 Plus