Clone BS28757 Report

Search the DGRC for BS28757

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:57
Vector:pDNR-Dual
Associated Gene/TranscriptCG12479-RA
Protein status:BS28757.pep: gold
Sequenced Size:257

Clone Sequence Records

BS28757.complete Sequence

257 bp assembled on 2012-03-26

GenBank Submission: KX800851

> BS28757.complete
GAAGTTATCAGTCGACATGTCGACTACTCCAGAGGATCGGCTGCGTGAGA
ACATCAATCGATGCCTCTCGGATTCCCTGGTGAAGGGAGTTGGTGGTCTG
GTGATCGGATCCGTGGTCACCCTGCTCTTCTTCCGTAGGCGCATATGGCC
CGTCTGGCTGGGCACTGGATTCGGCGTGGGCGTGGCATATCGTGGCTGTG
AAAAGGAGCTCAACGATGTAAAGTTTGGCCAACGAAAGTGAAAGCTTTCT
AGACCAT

BS28757.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG12479-RA 225 CG12479-PA 1..225 17..241 1125 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG12479-RA 428 CG12479-RA 93..317 17..241 1125 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 14151690..14151914 241..17 1125 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:18:17 has no hits.

BS28757.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:54 Download gff for BS28757.complete
Subject Subject Range Query Range Percent Splice Strand
CG12479-RA 93..316 17..240 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:54 Download gff for BS28757.complete
Subject Subject Range Query Range Percent Splice Strand
CG12479-RA 93..316 17..240 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:25:03 Download gff for BS28757.complete
Subject Subject Range Query Range Percent Splice Strand
CG12479-RA 93..316 17..240 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:25:03 Download gff for BS28757.complete
Subject Subject Range Query Range Percent Splice Strand
X 14151691..14151914 17..240 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:54 Download gff for BS28757.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14045724..14045947 17..240 100   Minus

BS28757.pep Sequence

Translation from 16 to 240

> BS28757.pep
MSTTPEDRLRENINRCLSDSLVKGVGGLVIGSVVTLLFFRRRIWPVWLGT
GFGVGVAYRGCEKELNDVKFGQRK*

BS28757.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG12479-PA 74 CG12479-PA 1..74 1..74 391 100 Plus
CG41128-PB 72 CG41128-PB 9..72 6..69 218 54.7 Plus
CG13564-PA 81 CG13564-PA 27..79 14..66 150 50.9 Plus