BS28757.complete Sequence
257 bp assembled on 2012-03-26
GenBank Submission: KX800851
> BS28757.complete
GAAGTTATCAGTCGACATGTCGACTACTCCAGAGGATCGGCTGCGTGAGA
ACATCAATCGATGCCTCTCGGATTCCCTGGTGAAGGGAGTTGGTGGTCTG
GTGATCGGATCCGTGGTCACCCTGCTCTTCTTCCGTAGGCGCATATGGCC
CGTCTGGCTGGGCACTGGATTCGGCGTGGGCGTGGCATATCGTGGCTGTG
AAAAGGAGCTCAACGATGTAAAGTTTGGCCAACGAAAGTGAAAGCTTTCT
AGACCAT
BS28757.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:18:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12479-RA | 225 | CG12479-PA | 1..225 | 17..241 | 1125 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:18:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12479-RA | 428 | CG12479-RA | 93..317 | 17..241 | 1125 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:18:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 14151690..14151914 | 241..17 | 1125 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 04:18:17 has no hits.
BS28757.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:54 Download gff for
BS28757.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12479-RA | 93..316 | 17..240 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:54 Download gff for
BS28757.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12479-RA | 93..316 | 17..240 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:25:03 Download gff for
BS28757.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12479-RA | 93..316 | 17..240 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:25:03 Download gff for
BS28757.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 14151691..14151914 | 17..240 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:54 Download gff for
BS28757.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 14045724..14045947 | 17..240 | 100 | | Minus |
BS28757.pep Sequence
Translation from 16 to 240
> BS28757.pep
MSTTPEDRLRENINRCLSDSLVKGVGGLVIGSVVTLLFFRRRIWPVWLGT
GFGVGVAYRGCEKELNDVKFGQRK*
BS28757.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12479-PA | 74 | CG12479-PA | 1..74 | 1..74 | 391 | 100 | Plus |
CG41128-PB | 72 | CG41128-PB | 9..72 | 6..69 | 218 | 54.7 | Plus |
CG13564-PA | 81 | CG13564-PA | 27..79 | 14..66 | 150 | 50.9 | Plus |