Clone BS28758 Report

Search the DGRC for BS28758

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG14143-RA
Protein status:BS28758.pep: gold
Sequenced Size:377

Clone Sequence Records

BS28758.complete Sequence

377 bp assembled on 2012-03-26

GenBank Submission: KX801645

> BS28758.complete
GAAGTTATCAGTCGACATGCGATCCCAGCTAACTATCTTCCTTGCCATCG
CGGCTTTCGTTTCGACTGCCTGGGCACTGACTTCTCCCGCCACGGTCACT
GTTTCATCGGTCACTGTTTCATCGGTCACTATTCCATCGGTCACTATTCC
TTCGGTCACTATTCCGACCACTGATACAGACACGTCCACCACTTCGCCTT
CGGCAACCGGAAGCAGCACCACCGTGACTCCCACCACCAAGAAACCAAAG
AAGAAGGCTACCGTTGTCCACTACAAGAAGAAGACCCACAAGTCGAACCG
ACGCCGCAAGTTCCGCCACTCACGTGATGGAAAGAGGAAGAACCGATCGA
GTTGGGAATAAAAGCTTTCTAGACCAT

BS28758.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG14143-RA 345 CG14143-PA 1..345 17..361 1725 100 Plus
CG32074-RA 333 CG32074-PA 1..333 17..361 1250 92 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG14143-RA 494 CG14143-RA 11..355 17..361 1725 100 Plus
CG32074-RA 440 CG32074-RA 3..335 17..361 1250 92 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11134997..11135341 17..361 1725 100 Plus
3L 28110227 3L 11131988..11132320 361..17 1250 92 Minus
Blast to na_te.dros performed on 2014-11-28 04:17:45 has no hits.

BS28758.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:49 Download gff for BS28758.complete
Subject Subject Range Query Range Percent Splice Strand
CG14143-RA 1..343 17..359 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:37 Download gff for BS28758.complete
Subject Subject Range Query Range Percent Splice Strand
CG14143-RA 11..353 17..359 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:50 Download gff for BS28758.complete
Subject Subject Range Query Range Percent Splice Strand
CG14143-RA 11..353 17..359 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:50 Download gff for BS28758.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11134997..11135339 17..359 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:37 Download gff for BS28758.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11128097..11128439 17..359 100   Plus

BS28758.pep Sequence

Translation from 16 to 360

> BS28758.pep
MRSQLTIFLAIAAFVSTAWALTSPATVTVSSVTVSSVTIPSVTIPSVTIP
TTDTDTSTTSPSATGSSTTVTPTTKKPKKKATVVHYKKKTHKSNRRRKFR
HSRDGKRKNRSSWE*

BS28758.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG14143-PA 114 CG14143-PA 1..114 1..114 572 100 Plus
CG32074-PA 110 CG32074-PA 1..110 1..114 501 91.3 Plus
nol-PA 130 CG32077-PA 1..123 1..110 276 53.7 Plus
CG33267-PB 94 CG33267-PB 18..91 27..104 137 37.2 Plus