Clone BS28771 Report

Search the DGRC for BS28771

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptCG14664-RA
Protein status:BS28771.pep: gold
Sequenced Size:287

Clone Sequence Records

BS28771.complete Sequence

287 bp assembled on 2012-03-26

GenBank Submission: KX800898

> BS28771.complete
GAAGTTATCAGTCGACATGAGGCTGCATCTTATACCACTGGTTGGACTCC
TTGCACTGATTATGGCCCAATCCCAAGTACTCCTACCGGGACTTCGCGTG
CGACAGGTTCCCGTGCTCGAAATGGGCCAGATTCCAGTGGTGCAGTACCT
GGACGCGGCCTCCACAGTCACTCCAGAGCTGGTAAAGGATCAGTTCAGCA
GGCGATTCACTACGCTGGCCAAACCCTTGGTCAGTGGTGCTGCTCCCCAA
ACCAGTCTCCCAAATTTGTAAAAGCTTTCTAGACCAT

BS28771.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG14664-RC 255 CG14664-PC 1..255 17..271 1275 100 Plus
CG14664-RB 255 CG14664-PB 1..255 17..271 1275 100 Plus
CG14664-RA 255 CG14664-PA 1..255 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14664-RC 1404 CG14664-RC 17..271 17..271 1275 100 Plus
CG14664-RB 360 CG14664-RB 17..271 17..271 1275 100 Plus
CG14664-RA 632 CG14664-RA 17..271 17..271 1275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5224155..5224409 17..271 1275 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:18:24 has no hits.

BS28771.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:55 Download gff for BS28771.complete
Subject Subject Range Query Range Percent Splice Strand
CG14664-RA 17..269 17..269 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:59 Download gff for BS28771.complete
Subject Subject Range Query Range Percent Splice Strand
CG14664-RA 17..269 17..269 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:25:06 Download gff for BS28771.complete
Subject Subject Range Query Range Percent Splice Strand
CG14664-RA 17..269 17..269 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:25:06 Download gff for BS28771.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5224155..5224407 17..269 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:59 Download gff for BS28771.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1049877..1050129 17..269 100   Plus

BS28771.pep Sequence

Translation from 16 to 270

> BS28771.pep
MRLHLIPLVGLLALIMAQSQVLLPGLRVRQVPVLEMGQIPVVQYLDAAST
VTPELVKDQFSRRFTTLAKPLVSGAAPQTSLPNL*

BS28771.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG14664-PC 84 CG14664-PC 1..84 1..84 409 100 Plus
CG14664-PB 84 CG14664-PB 1..84 1..84 409 100 Plus
CG14664-PA 84 CG14664-PA 1..84 1..84 409 100 Plus