BS28771.complete Sequence
287 bp assembled on 2012-03-26
GenBank Submission: KX800898
> BS28771.complete
GAAGTTATCAGTCGACATGAGGCTGCATCTTATACCACTGGTTGGACTCC
TTGCACTGATTATGGCCCAATCCCAAGTACTCCTACCGGGACTTCGCGTG
CGACAGGTTCCCGTGCTCGAAATGGGCCAGATTCCAGTGGTGCAGTACCT
GGACGCGGCCTCCACAGTCACTCCAGAGCTGGTAAAGGATCAGTTCAGCA
GGCGATTCACTACGCTGGCCAAACCCTTGGTCAGTGGTGCTGCTCCCCAA
ACCAGTCTCCCAAATTTGTAAAAGCTTTCTAGACCAT
BS28771.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:18:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14664-RC | 255 | CG14664-PC | 1..255 | 17..271 | 1275 | 100 | Plus |
CG14664-RB | 255 | CG14664-PB | 1..255 | 17..271 | 1275 | 100 | Plus |
CG14664-RA | 255 | CG14664-PA | 1..255 | 17..271 | 1275 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:18:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14664-RC | 1404 | CG14664-RC | 17..271 | 17..271 | 1275 | 100 | Plus |
CG14664-RB | 360 | CG14664-RB | 17..271 | 17..271 | 1275 | 100 | Plus |
CG14664-RA | 632 | CG14664-RA | 17..271 | 17..271 | 1275 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:18:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 5224155..5224409 | 17..271 | 1275 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:18:24 has no hits.
BS28771.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:55 Download gff for
BS28771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14664-RA | 17..269 | 17..269 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:15:59 Download gff for
BS28771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14664-RA | 17..269 | 17..269 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:25:06 Download gff for
BS28771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14664-RA | 17..269 | 17..269 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:25:06 Download gff for
BS28771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 5224155..5224407 | 17..269 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:15:59 Download gff for
BS28771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 1049877..1050129 | 17..269 | 100 | | Plus |
BS28771.pep Sequence
Translation from 16 to 270
> BS28771.pep
MRLHLIPLVGLLALIMAQSQVLLPGLRVRQVPVLEMGQIPVVQYLDAAST
VTPELVKDQFSRRFTTLAKPLVSGAAPQTSLPNL*
BS28771.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14664-PC | 84 | CG14664-PC | 1..84 | 1..84 | 409 | 100 | Plus |
CG14664-PB | 84 | CG14664-PB | 1..84 | 1..84 | 409 | 100 | Plus |
CG14664-PA | 84 | CG14664-PA | 1..84 | 1..84 | 409 | 100 | Plus |