Clone BS28778 Report

Search the DGRC for BS28778

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:287
Well:78
Vector:pDNR-Dual
Associated Gene/TranscriptCG42659-RB
Protein status:BS28778.pep: gold
Sequenced Size:181

Clone Sequence Records

BS28778.complete Sequence

181 bp assembled on 2012-03-26

GenBank Submission: KX802742

> BS28778.complete
GAAGTTATCAGTCGACATGGTTTACTTAAGTCGTCCTTGGACTCCGGCCA
TAAACCCTTTCTACATTGGCCCCTATCCGAGATGCGCAGTATGTCCGTGC
AACTTCGACATTTACAAAGGATACACCCCCGGTGGCTGGCACAGTCGTTG
CTATAGCAGCTATTAAAGCTTTCTAGACCAT

BS28778.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG42659-RB 150 CG42659-PB 1..148 17..164 740 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42659-RB 429 CG42659-RB 155..302 17..164 740 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18007568..18007715 17..164 740 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:18:50 has no hits.

BS28778.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:59 Download gff for BS28778.complete
Subject Subject Range Query Range Percent Splice Strand
CG42659-RB 155..302 17..164 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:16:14 Download gff for BS28778.complete
Subject Subject Range Query Range Percent Splice Strand
CG42659-RB 155..302 17..164 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:25:19 Download gff for BS28778.complete
Subject Subject Range Query Range Percent Splice Strand
CG42659-RB 155..302 17..164 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:25:19 Download gff for BS28778.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18007568..18007715 17..164 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:16:14 Download gff for BS28778.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18007568..18007715 17..164 100   Plus

BS28778.pep Sequence

Translation from 16 to 165

> BS28778.pep
MVYLSRPWTPAINPFYIGPYPRCAVCPCNFDIYKGYTPGGWHSRCYSSY*

BS28778.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG42659-PB 49 CG42659-PB 1..49 1..49 301 100 Plus