BS28778.complete Sequence
181 bp assembled on 2012-03-26
GenBank Submission: KX802742
> BS28778.complete
GAAGTTATCAGTCGACATGGTTTACTTAAGTCGTCCTTGGACTCCGGCCA
TAAACCCTTTCTACATTGGCCCCTATCCGAGATGCGCAGTATGTCCGTGC
AACTTCGACATTTACAAAGGATACACCCCCGGTGGCTGGCACAGTCGTTG
CTATAGCAGCTATTAAAGCTTTCTAGACCAT
BS28778.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:18:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42659-RB | 150 | CG42659-PB | 1..148 | 17..164 | 740 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:18:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42659-RB | 429 | CG42659-RB | 155..302 | 17..164 | 740 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:18:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18007568..18007715 | 17..164 | 740 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:18:50 has no hits.
BS28778.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:14:59 Download gff for
BS28778.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42659-RB | 155..302 | 17..164 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:16:14 Download gff for
BS28778.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42659-RB | 155..302 | 17..164 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:25:19 Download gff for
BS28778.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42659-RB | 155..302 | 17..164 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:25:19 Download gff for
BS28778.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18007568..18007715 | 17..164 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:16:14 Download gff for
BS28778.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 18007568..18007715 | 17..164 | 100 | | Plus |
BS28778.pep Sequence
Translation from 16 to 165
> BS28778.pep
MVYLSRPWTPAINPFYIGPYPRCAVCPCNFDIYKGYTPGGWHSRCYSSY*
BS28778.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:11:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42659-PB | 49 | CG42659-PB | 1..49 | 1..49 | 301 | 100 | Plus |