BS28788.complete Sequence
284 bp assembled on 2012-03-26
GenBank Submission: KX801550
> BS28788.complete
GAAGTTATCAGTCGACATGTTCCGCATTATCGCTGTAATCTTCGCCCTGG
TAGCAATGGCTTTTGCTGCTCCTGGTTACATTGAGCCCTCCTACGGAGTG
GTTCCTGTGGCCCAGGTGGTGCCCGTGGTGAAATCTGTTCCGGTGGTGAA
GCATGTTCCAGTGGTGCAGCATGTTCCGGTGGTGAAAAATGTCCCAGTGG
TTCAGCATGTCCCTGTGCTGAAGTCCTACGCTGTTCCCACCTATGGACAC
CACATCTACCATGGTTAAAAGCTTTCTAGACCAT
BS28788.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:19:11
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34268-RA | 252 | CG34268-PA | 1..252 | 17..268 | 1260 | 100 | Plus |
| CG34267-RA | 234 | CG34267-PA | 1..234 | 17..268 | 850 | 90.1 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:19:12
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34268-RA | 373 | CG34268-RA | 61..313 | 17..269 | 1265 | 100 | Plus |
| CG34267-RA | 375 | CG34267-RA | 79..313 | 17..269 | 855 | 90.1 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:19:09
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 501100..501340 | 29..269 | 1205 | 100 | Plus |
| 3L | 28110227 | 3L | 500076..500298 | 269..29 | 795 | 89.6 | Minus |
Blast to na_te.dros performed on 2014-11-28 04:19:10 has no hits.
BS28788.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-03-26 11:15:03 Download gff for
BS28788.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34268-RA | 67..311 | 22..266 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:16:25 Download gff for
BS28788.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34268-RA | 66..310 | 22..266 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:25:28 Download gff for
BS28788.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34268-RA | 66..310 | 22..266 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:25:28 Download gff for
BS28788.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 501094..501337 | 22..266 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:16:25 Download gff for
BS28788.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 501094..501337 | 22..266 | 98 | | Plus |
BS28788.pep Sequence
Translation from 16 to 267
> BS28788.pep
MFRIIAVIFALVAMAFAAPGYIEPSYGVVPVAQVVPVVKSVPVVKHVPVV
QHVPVVKNVPVVQHVPVLKSYAVPTYGHHIYHG*
BS28788.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:11:24
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34268-PA | 83 | CG34268-PA | 1..83 | 1..83 | 429 | 100 | Plus |
| CG34267-PA | 77 | CG34267-PA | 1..77 | 1..83 | 380 | 92.8 | Plus |
| CG15308-PB | 95 | CG15308-PB | 5..70 | 5..70 | 140 | 48.5 | Plus |
| CG15308-PC | 82 | CG15308-PC | 1..57 | 14..70 | 134 | 52.6 | Plus |
